Recombinant Mouse C-C chemokine receptor type 4 (Ccr4)

In Stock
Code CSB-CF004843MO
Abbreviation Recombinant Mouse Ccr4 protein
MSDS
Size $2160
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 85% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
C-C CKR-4; CC-CKR-4; CCR-4; CCR4;CD194
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
1-360aa
Target Protein Sequence
MNATEVTDTTQDETVYNSYYFYESMPKPCTKEGIKAFGEVFLPPLYSLVFLLGLFGNSVVVLVLFKYKRLKSMTDVYLLNLAISDLLFVLSLPFWGYYAADQWVFGLGLCKIVSWMYLVGFYSGIFFIMLMSIDRYLAIVHAVFSLKARTLTYGVITSLITWSVAVFASLPGLLFSTCYTEHNHTYCKTQYSVNSTTWKVLSSLEINVLGLLIPLGIMLFCYSMIIRTLQHCKNEKKNRAVRMIFAVVVLFLGFWTPYNVVLFLETLVELEVLQDCTLERYLDYAIQATETLAFIHCCLNPVIYFFLGEKFRKYITQLFRTCRGPLVLCKHCDFLQVYSADMSSSSYTQSTVDHDFRDAL
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
42.9 kDa
Protein Length
Full Length
Tag Info
N-terminal 10xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
High affinity receptor for the C-C type chemokines CCL17/TARC and CCL22/MDC. The activity of this receptor is mediated by G(i) proteins which activate a phosphatidylinositol-calcium second messenger system. Could play a role in lipopolysaccharide (LPS)-induced endotoxic shock. In the CNS, could mediate hippocampal-neuron survival.
Gene References into Functions
  1. data demonstrate a mechanistic or developmental role of CCR4 in the regulation of locomotor and exploratory behaviors PMID: 27469058
  2. A CCR4 antagonist reverses the tumor-promoting microenvironment of renal cancer PMID: 28134623
  3. CCR4 is critically involved in regional lymph node dendritic cell-Th17 cell interactions that are necessary for Th17 cell-mediated induction of antitumor CD8+ effector T cells in mice bearing B16 melanoma. PMID: 27132989
  4. CCR4 is involved in immunosuppression after severe sepsis and suggest that CCR4+ Regulatory T Cells negatively modulate the short and long-term immune responses. PMID: 26197455
  5. CCL22 was localised mainly on the cell surface and or in the cytoplasm. Within sections of omental milky spot micrometastases, CCR4 was recognised on or in gastric cancer cells, constituent cells milky spots, blood cells and blood endothelial cells PMID: 25245466
  6. CCR4 is involved in regulating negative selection of polyclonal and T cell receptor (TCR) transgenic thymocytes PMID: 26417005
  7. results show that the IL-4/CCL22/CCR4 axis is involved in the migration of Tregs to osteolytic lesion sites, and attenuates development of lesions by inhibiting inflammatory migration and the production of proinflammatory and osteoclastogenic mediators PMID: 25264308
  8. These data have uncovered a novel role of core components of the Ccr4-Not complex as regulators of transition from partial to genuine induced pluripotent stem cells. PMID: 24200330
  9. that effective engagement of CCR4 by CCL17 involves two distinct binding domains and interaction with both is required for signaling PMID: 24339934
  10. NF-kappaB signaling pathway was involved in the asthmatic change induced by CKLF1, among which CCR4 might play a crucial role PMID: 24583145
  11. CCR4-expressing Th2cells play a critical role in the pathogenesis of bronchial asthma by producing Th2 cytokines. PMID: 24238232
  12. CCR4 promotes natural killer cell priming/activation by mediating contacts with sentinel cells in the lung. PMID: 24333113
  13. Combining a panel of thymocyte maturation markers with cell surface analysis of CCR7 and CCR4 identifies distinct stages in the development of multiple alphabetaT cell lineages in the adult thymus. PMID: 24990081
  14. lung dendritic cells imprint T cell lung homing and promote lung immunity in part through CCR4. PMID: 23960189
  15. CCR4-deficient mice have a more rapid progression of experimental autoimmune encephalomyelitis. PMID: 23477966
  16. CCR4.exacerbated allergic inflammation of CCR4KO mice was directly associated with an impaired migration of regulatory (Treg) cells to airways and augmented frequency of pulmonary T helper (Th)2 cells. PMID: 23390295
  17. CCR4 plays an important role in T reg cell trafficking in lymph nodes and that this is critical for T reg cell suppressive function in inflammatory bowel disease. PMID: 17548518
  18. CCR4 is not T helper (Th) type 2 cell-restricted and is required for sustenance and expression of the Th1 effector/memory response to mycobacterial antigens. PMID: 16951380
  19. CC chemokine receptor 4 is required for experimental autoimmune encephalomyelitis by regulating GM-CSF and IL-23 production in dendritic cells PMID: 22355103
  20. After lentivirus-mediated shRNA treatment of Dox-treated CD200tg mice to attenuate expression of CCR4 mRNA, the increased localization of Treg cells in skin/DLN of CD200tg recipients of skin grafts was abolished. PMID: 21945175
  21. CCR-4 deficiency was characterised by a moderate decrease in the amount of neutrophils sequestered in the lungs. PMID: 21345872
  22. CCR4 regulates experimental autoimmune encephalomyelitis (EAE) development and is involved in inflammatory macrophage effector function during EAE. PMID: 21575994
  23. Data show that the presence of the Ccr4 and Ccl22 transcripts were detected in brain slices. PMID: 21177120
  24. The CCR4 appeared to be required for sustaining the local pulmonary memory effector response in the long-term but not early bacterial elimination stage of Mycobacterium bovis infection. PMID: 21224060
  25. the absence of CCR4 results in enhanced secondary immune response during allergic skin inflammation PMID: 20631725
  26. Embryonic trafficking of gammadelta T cells to skin is dependent on E/P selectin ligands and CCR4 PMID: 20368416
  27. we report an unexpected role for CCR4 and CCL17 in NKT cell-licensed cross-priming. PMID: 20190758
  28. airway hyperresponsiveness, but not airway remodeling, is attenuated during chronic pulmonary allergic responses to Aspergillus in CCR4-/- mice PMID: 12154006
  29. T cells bearing this receptor participate in autoimmune diabetes. PMID: 12464673
  30. CLA/E-selectin interactions plays a role in CCR4-mediated recruitment of human Th2 memory cells to human skin in vivo. PMID: 12555662
  31. role in acute and chronic cardiac allograft rejection PMID: 15593118
  32. CCR4 expression provides a competitive advantage to cutaneous T helper cells, either by participating in their development from naive Th cells, or by preferentially maintaining them within the memory population over time. PMID: 15795234
  33. Recruitment of Foxp3+ T regulatory cells mediating allograft tolerance depends on the CCR4 chemokine receptor. PMID: 15809349
  34. pulmonary localization of iNKT cells critical for the induction of AHR requires CCR4 expression by iNKT cells PMID: 17878364
  35. study provides direct evidence for the presence of CCR4 and its ligands, CCL17 and CCL22, in mouse contact hypersensitivity PMID: 18052724
  36. CCL17-dependent activation of CCR4 in macrophages plays a central role in free radical-induced pulmonary injury and repair. PMID: 18403600
  37. macrophages deficient in CCR4 impart a regulatory influence on TLR9-mediated innate immunity. PMID: 18624303
  38. CCR4 plays a strictly detrimental role in the course of polymicrobial sepsis PMID: 18765730
  39. Contribution of CCR4 and CCR8 to antigen-specific T(H)2 cell trafficking in allergic pulmonary inflammation. PMID: 19062085

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family
Tissue Specificity
Expressed in the thymus, macrophages and T- and B-cells.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*