Recombinant Mouse Follicle-stimulating hormone receptor (Fshr)

Code CSB-CF009021MO
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Fshr
Uniprot No.
Alternative Names
Fshr; Follicle-stimulating hormone receptor; FSH-R; Follitropin receptor
Species
Mus musculus (Mouse)
Expression Region
18-692
Target Protein Sequence
CHHWLCHCSNRVFLCQDSKVTEIPPDLPRNAIELRFVLTKLRVIPKGSFSGFGDLEKIEI SQNDVLEVIEADVFSNLPNLHEIRIEKANNLLYINPEAFQNLPSLRYLLISNTGIKHLPA FHKIQSLQKVLLDIQDNINIHIIARNSFMGLSFESVILWLNKNGIQEIHNCAFNGTQLDE LNLSDNNNLEELPDDVFQGASGPVVLDISRTKVYSLPNHGLENLKKLRARSTYRLKKLPS LDKFVMLIEASLTYPSHCCAFANWRRQTSELHPICNKSISRQDIDDMTQPGDQRVSLVDD EPSYGKGSDMLYSEFDYDLCNEFVDVTCSPKPDAFNPCEDIMGYNILRVLIWFISILAIT GNTTVLVVLTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQT GAGCDAAGFFTVFASELSVYTLAAITLERWHTITHAMQLECKVQLCHAASIMVLGWAFAF AAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMALLVLNALAFVVICGCYTHIYLTVRN PNIVSSSRDTKIAKRMATLIFTDFLCMAPILFFAISASLKVPLITVSKAKILLVLFYPIN SCANPFLYAIFTKNFRRDFFVLMSKFGCYEVQAQIYKTETSSITHNFHSRKNPCSSAPRV TNSYVLVPLNHSVQN
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are interested in the following protein Recombinant Mouse Follicle-stimulating hormone receptor (Fshr) (CSB-CF009021MO). My understanding is that you have not expressed this protein. However, if you are able to express the protein we would purchase a small quantity first to test it out. We would also like bulk pricing for 4mg so we know how to budget. Can you please provide our bulk price for 4mg as reference?

A:
Thanks for your inquiry.
Recombinant Mouse Follicle-stimulating hormone receptor(Fshr)
CSB-CF009021MO
Expression Region: 18-692aa; Full length of the mature protein.
Tag information:Tag type will be determined during the manufacturing process. (The expected tag is N-terminal 10xHis-tagged)
Sequence:

CHHWLCHCSNRVFLCQDSKVTEIPPDLPRNAIELRFVLTKLRVIPKGSFSGFGDLEKIEISQNDVLEVIEADVFSNLPNLHEIRIEKANNLLYINPEAFQNLPSLRYLLISNTGIKHLPAFHKIQSLQKVLLDIQDNINIHIIARNSFMGLSFESVILWLNKNGIQEIHNCAFNGTQLDELNLSDNNNLEELPDDVFQGASGPVVLDISRTKVYSLPNHGLENLKKLRARSTYRLKKLPSLDKFVMLIEASLTYPSHCCAFANWRRQTSELHPICNKSISRQDIDDMTQPGDQRVSLVDDEPSYGKGSDMLYSEFDYDLCNEFVDVTCSPKPDAFNPCEDIMGYNILRVLIWFISILAITGNTTVLVVLTTSQYKLTVPRFLMCNLAFADLCIGIYLLLIASVDIHTKSQYHNYAIDWQTGAGCDAAGFFTVFASELSVYTLAAITLERWHTITHAMQLECKVQLCHAASIMVLGWAFAFAAALFPIFGISSYMKVSICLPMDIDSPLSQLYVMALLVLNALAFVVICGCYTHIYLTVRNPNIVSSSRDTKIAKRMATLIFTDFLCMAPILFFAISASLKVPLITVSKAKILLVLFYPINSCANPFLYAIFTKNFRRDFFVLMSKFGCYEVQAQIYKTETSSITHNFHSRKNPCSSAPRVTNSYVLVPLNHSVQN


Statement:
As we checked that this full length protein nearly hasn't been expressed on the market, there is very a few reference information, and this protein itself is very large,
it has some difficulty to express, probably it will finally not being expressed, however, we can still try it as risk-free service, if it's finally failed, we will not charge any fees. You can decide by yourself whether to have a try or not considering the high risk.
Yes, we haven't expressed this protein before, and this protein expression exists some difficulty after our evaluation. We can still try it as risk-free service, if it's finally failed, we will not charge any fees.We recommend you to choose a small size to have try, since we haven't expressed, we don't know the yield, we can offer a price of 4mg for your reference.The 4mg protein will be provided in several batches. Probably we can consider to offer additional discount based on the yield if the protein is successfully expressed.

Target Background

Function
G protein-coupled receptor for follitropin, the follicle-stimulating hormone. Through cAMP production activates the downstream PI3K-AKT and ERK1/ERK2 signaling pathways.
Gene References into Functions
  1. These data highlight an important interdependency between the potent pro-inflammatory cytokine IL1A and Fshr expression. PMID: 28337831
  2. Mouse chondrocytes and human articular cartilage express functional FSHR. Moreover, FSH can act on chondrocytes and cause genetic changes. PMID: 29133260
  3. Study demonstrates expression of follicle-stimulating hormone receptor (FSHR) and a direct action of follicle-stimulating hormone on testicular stem/germ cells possibly mediated via alternatively spliced growth factor type 1 receptor FSHR3 in mice. PMID: 27189070
  4. FSHR and LHR proteins are significantly upregulated in CCs surrounding oocytes arrested at the 2-cell stage, reflecting their developmental incompetence. PMID: 24476692
  5. Data (including date from knockout mice) suggest that Fshr is expressed early in pregnany in placenta and other extragonadal tissues of fetoplacental unit; expression is particularly strong at term. PMID: 25100706
  6. Sertoli cell-specific expression of MTA2 is required for transcriptional regulation of FSHR gene during spermatogenesis. PMID: 23086931
  7. The results demonstrate that gain-of-function mutations of the FSHR in mice bring about distinct and clear changes in ovarian function PMID: 20172968
  8. haploinsufficiency of the follicle-stimulating hormone receptor accelerates oocyte loss inducing early reproductive senescence and biological aging in mice PMID: 12135868
  9. show that FSH-R haploinsufficiency leads to a decrease in ovulation, altered ovarian steroidogenesis, and neuroendocrine impairments resulting in early reproductive senescence PMID: 12135869
  10. the loss of FSH-R signaling alters the follicular environment, where oocyte-granulosa interactions are perturbed, creating an out-of-phase germ cell and somatic cell development PMID: 12801992
  11. Chronic depletion of sex hormone E2 from early development leads to neural impairments in adult and aged FORKO mice that are associated with hypertrophy of glial cells, cell loss in distinct brain regions, and abnormal anxiety behavior PMID: 14552897
  12. These results suggest that FSH-R signaling normally maintains water balance in Sertoli cells in addition to regulating androgen-binding protein production. (FSH receptor) PMID: 14998910
  13. shrinkage in epididymal epithelial areas observed in follicle stimulating hormone receptor knockout mice PMID: 15973687
  14. loss of FSH-R signaling causes an imbalance of PDGF family members predisposing the abnormal ovarian follicular environment for inducing tumorigenesis in aging FORKO mice PMID: 16344272
  15. The complex cellular biology of follitropin receptors that may interact differently with polymorphic forms (glycosylation variants) of FSH represents an intricate scheme to regulate hormone signaling. PMID: 17081682
  16. These data suggest that FSH-R3 signaling promotes proliferation of ovarian cancer cells. PMID: 17234334
  17. FORKO mice developed age-dependent declines in bone mineral density and trabecular bone volume of the lumbar spine and femur, which could be partly reversed by ovarian transplantation. PMID: 17332067
  18. Gender-specific impairments in translocation of phosphorylated map erk kinases were found in the CNS structures in aged FSH-R knockout mice. PMID: 17470386
  19. FSHR gene expression is regulated distinctly in the osteoclast, and differently from other cells, such as the ovarian follicular and Leydig cells. PMID: 17681281
  20. Follitropin-receptor knockout (FORKO) females have an impaired natriuretic peptide system, which may contribute to the susceptibility of FORKO mice to developing age-related hypertension previously shown in these animals. PMID: 18063689
  21. USF1 and USF2 bind the Fshr promoter and revealed differences between Sertoli and granulosa cells in compensatory responses to USF loss and the USF dimeric composition required for Fshr transcription PMID: 18566134

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Protein Families
G-protein coupled receptor 1 family, FSH/LSH/TSH subfamily
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1