Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha(Fcer1a)

In Stock
Code CSB-CF008532MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P20489
Lead Time 3-7 business days
Relevance Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT
Research Area Immunology
Source in vitro E.coli expression system
Gene Names Fcer1a
Protein Names Fc-epsilon RI-alpha
Expression Region 24-250aa
Tag Info N-terminal 10xHis-SUMO-tagged
Mol. Weight 44.7kDa
Protein Description Full Length of Mature Protein
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Tissue Specificity Expressed in bone marrow mast cells, as well as in the pineal gland at night.
Database Links

KEGG: mmu:14125

STRING: 10090.ENSMUSP00000056882

UniGene: Mm.5266

Pathway Fc epsilon RI signaling pathway
Oxidative Phosphorylation
Phospholipase D signaling pathway
Sphingolipid signaling pathway

Related Products

Fcer1a Proteins

Fcer1a Proteins for Mus musculus (Mouse)

Fcer1a ELISA Kit

Fcer1a ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.