Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a)

In Stock
Code CSB-CF008532MO
Abbreviation Recombinant Mouse Fcer1a protein
MSDS
Size $1620
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Fcer1a; Fce1a; High affinity immunoglobulin epsilon receptor subunit alpha; Fc-epsilon RI-alpha; FcERI; IgE Fc receptor subunit alpha
Species
Mus musculus (Mouse)
Source
in vitro E.coli expression system
Expression Region
24-250aa
Target Protein Sequence
ATEKSVLTLDPPWIRIFTGEKVTLSCYGNNHLQMNSTTKWIHNGTVSEVNSSHLVIVSATVQDSGKYICQKQGLFKSKPVYLNVTQDWLLLQTSADMVLVHGSFDIRCHGWKNWNVRKVIYYRNDHAFNYSYESPVSIREATLNDSGTYHCKGYLRQVKYESDKFRIAVVKAYKCKYYWLQLIFPLLVAILFAVDTGLLLSTEEQFKSVLEIQKTGKYKKVETELLT
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
44.7kDa
Protein Length
Full Length of Mature Protein
Tag Info
N-terminal 10xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Mouse High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a) is produced using an in vitro E.coli expression system, spanning the full mature protein length from amino acids 24 to 250. This protein carries an N-terminal 10xHis-SUMO tag, which provides easier purification and enhanced stability. The product achieves over 90% purity as confirmed by SDS-PAGE, making it appropriate for various research applications.

The High affinity immunoglobulin epsilon receptor subunit alpha (Fcer1a) appears to be a crucial component of the immunoglobulin E (IgE) receptor complex, largely involved in allergic responses. It likely plays a central role in the signal transduction pathway that triggers mediator release from mast cells and basophils. Understanding Fcer1a may be essential for research into allergy mechanisms and developing therapeutic interventions.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Mouse Fcer1a is an immunoglobulin superfamily receptor that requires precise folding, proper disulfide bond formation (with 7 conserved disulfide bonds), and specific domain organization for its high-affinity IgE binding activity. The in vitro E. coli expression system (cell-free) cannot provide the necessary eukaryotic folding environment, oxidative conditions for disulfide bond formation, or post-translational modifications required for this complex receptor. The large N-terminal 10xHis-SUMO tag (∼15 kDa) may sterically interfere with the protein's functional domains and binding interfaces. While cell-free systems can produce soluble proteins, the probability of correct folding with functional IgE binding activity is extremely low.

1. Antibody Development and Validation Studies

This application is highly suitable as antibody development primarily relies on linear epitope recognition rather than functional protein folding. The protein can generate antibodies against the Fcer1a sequence (24-250aa), though these antibodies may not recognize conformational epitopes dependent on proper disulfide bonding in the native receptor. The high purity (>90%) ensures minimal contamination-related issues during immunization protocols.

2. Biochemical Characterization

Basic biophysical characterization can be performed, but it will not reflect native structure because the expression system cannot support proper disulfide bond formation. Techniques like circular dichroism may detect secondary structure but cannot verify functional disulfide bonding, and structural biology techniques requiring native folding will not yield meaningful results for this misfolded protein.

3. ELISA Development and Immunoassay Applications

This application is suitable for detecting antibodies against linear epitopes but not for functional ligand binding studies because immunoassays for antibody detection rely on sequence recognition rather than functional conformation. The protein can serve as a coating antigen for antibody detection, but cannot model native IgE-receptor interactions due to the lack of proper disulfide bonding.

Final Recommendation & Action Plan

The in vitro E. coli expression system is fundamentally unsuitable for producing a functional Fcer1a receptor due to its inability to form the essential disulfide bonds required for proper immunoglobulin domain folding. This recombinant protein is only suitable for Application 1 (antibody development against linear epitopes) and basic aspects of Application 3 (ELISA for antibody detection). Structural and functional studies are not recommended because they require precise disulfide-dependent tertiary structure and native receptor conformation with correct disulfide bonds, respectively, that cannot be achieved in the cell-free expression system. For reliable Fcer1a research requiring functional activity, use mammalian expression systems that support proper disulfide bond formation and receptor folding.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds to the Fc region of immunoglobulins epsilon. High affinity receptor. Responsible for initiating the allergic response. Binding of allergen to receptor-bound IgE leads to cell activation and the release of mediators (such as histamine) responsible for the manifestations of allergy. The same receptor also induces the secretion of important lymphokines.
Gene References into Functions
  1. House Dust Mite-Induced Allergic Airway Disease Is Independent of IgE and FcepsilonRIalpha. PMID: 28700253
  2. this study shows that mast cells co-cultured with macrophages alter protein expression of both cell types, and that mast cells transfer FceRI-encompassed cellular regions directly to macrophages during Francisella tularensis PMID: 27554051
  3. Tim-3 acts at a receptor-proximal point to enhance Lyn kinase-dependent signaling pathways that modulate both immediate-phase degranulation and late-phase cytokine production downstream of FcepsilonRI ligation. PMID: 26598760
  4. Conferring expression of FcepsilonRI to dendritic cells decreases the severity of food allergy and asthma in disease-relevant models suggesting anti-inflammatory IgE/FcepsilonRI signals. PMID: 25227985
  5. IgE-mediated activation of dendritic cells via IgE receptors binding in allergic Th2-type inflammation appears to be immune regulatory rather than pro-inflammatory. (Review) PMID: 26052071
  6. Specific cross-linking of the high affinity immunoglobulin epsilon receptor on the surface of bone marrow-derived mast cells and heart mast cells elicits the release of enzymatically active renin protein. PMID: 24262755
  7. Zinc-binding MT1 and MT2 are key modulators of Fc epsilonRI-induced basophil production of IL-4. PMID: 25801306
  8. Loss of Tespa1 in mouse mast cells led to hyper-responsiveness to stimulation via FcepsilonRI. PMID: 25422497
  9. IgE-mediated allergic hypersensitivity provokes release of renin from both cultured and resident cardiac mast cells. PMID: 24262755
  10. Overexpression of miR-142-3p enhances FcepsilonRI-mediated degranulation. PMID: 24361879
  11. OX40L engagement impairs FcepsilonRI activation and Gab2/PI3K/Akt, but not Syk/LAT, phosphorylation PMID: 22564682
  12. FcepsilonRI, but not FcgammaR, signals induce prostaglandin D2 and E2 production from basophils PMID: 21712025
  13. data implicate Fyn as the major positive mediator of STAT5 after FcepsilonRI engagement and demonstrate importantly distinct roles for STAT5A and STAT5B in mast cell function. PMID: 22130676
  14. Reduced IgE/antigen-mediated passive cutaneous anaphylaxis is detected in mice with Piga-deficient mast cells. PMID: 21865342
  15. The PI3K binding site is involved in FcepsilonRI-dependent ARF1 activation and granule translocation to the plasma membrane in the degranulation process, further dissecting the signals required for degranulation. PMID: 21653832
  16. Whereas FcepsilonRI required Lyn and Syk for NTAL phosphorylation, Kit appeared to directly phosphorylate NTAL. PMID: 17993265
  17. This is the first observation to attribute a spatiotemporally restricted antigen-presenting function to a subset of three-week old pure BMMC expressing both high levels of surface FcepsilonRI and surface major histocompatibility complex II. PMID: 20591187
  18. Peripheral blood basophils express approximately 50% of the Fc epsilon RI density of bone marrow (BM) basophils. A 3-fold greater synthetic rate of Fc epsilon RI on BM basophils readily explains the difference. PMID: 20042574
  19. Fc epsilon RI-mediated calcium flux (dependent on PLC gamma 1) leads to degranulation of mast cells independent of PI 3-kinase PMID: 13129935
  20. FcepsilonRI stimulation triggers the formation of microtubules in a manner independent of calcium. Drugs affecting microtubule dynamics effectively suppressed the FcepsilonRI-mediated translocation of granules to the plasma membrane and degranulation. PMID: 15998803
  21. SHIP and Src homology 2 domain-containing protein tyrosine phosphatase-1 interacted with FcepsilonRI beta, and their phosphorylation was controlled by Lyn. PMID: 16272347
  22. Fc receptor gamma RI interacts with the unrelated immunoreceptors FcalphaRI and FcepsilonRI PMID: 16627486
  23. The length of the stalk region of the alpha-chain is an important determinant of Fc epsilon receptor IA stability on the cell surface. PMID: 16709862
  24. IL-33 prolonged mast cell survival in the absence of IgE and impaired survival in the presence of SPE-7 IgE. PMID: 17881510
  25. These findings show that the extracellular domain of the type I transmembrane protein Fc epsilon RI alpha plays a role in Fc epsilon RI intracellular processing and expression at the cell surface. PMID: 18179824
  26. the high affinity of IgE for FcepsilonRI is critical to the allergic response, and that even moderate attenuation of this affinity has a substantial effect in vivo PMID: 18703499
  27. positive and negative regulators of FcepsilonRI have roles in mast cell activation [review] PMID: 19082920
  28. autoantibodies against Fcer1a is present in 30-50% urticaria patients PMID: 19331714
  29. Fc(epsilon)RIand CD16 thus contribute to atopic dermatitis but differentially regulate immune responses associated with the disease. PMID: 19414806
  30. the role of PI3Kgamma on the Fc epsilon RI mediated mast cell migration. PMID: 19494508
  31. Data suggest that PTPepsilon negatively regulates FcepsilonRI-mediated signalling pathways and thus constitutes a novel target for ameliorating allergic conditions. PMID: 19508371

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in bone marrow mast cells, as well as in the pineal gland at night.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*