Recombinant Mouse Interferon gamma receptor 1(Ifngr1)

Code CSB-CF011051MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P15261
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence GSGALTSTEDPEPPSVPVPTNVLIKSYNLNPVVCWEYQNMSQTPIFTVQVKVYSGSWTDSCTNISDHCCNIYEQIMYPDVSAWARVKAKVGQKESDYARSKEFLMCLKGKVGPPGLEIRRKKEEQLSVLVFHPEVVVNGESQGTMFGDGSTCYTFDYTVYVEHNRSGEILHTKHTVEKEECNETLCELNISVSTLDSRYCISVDGISSFWQVRTEKSKDVCIPPFHDDRKDSIWILVVAPLTVFTVVILVFAYWYTKKNSFKRKSIMLPKSLLSVVKSATLETKPESKYSLVTPHQPAVLESETVICEEPLSTVTAPDSPEAAEQEELSKETKALEAGGSTSAMTPDSPPTPTQRRSFSLLSSNQSGPCSLTAYHSRNGSDSGLVGSGSSISDLESLPNNNSETKMAEHDPPPVRKAPMASGYDKPHMLVDVLVDVGGKESLMGYRLTGEAQELS
Source in vitro E.coli expression system
Gene Names Ifngr1
Protein Names Recommended name: Interferon gamma receptor 1 Short name= IFN-gamma receptor 1 Short name= IFN-gamma-R1 Alternative name(s): CD_antigen= CD119
Expression Region 23-477
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Associates with IFNGR2 to form a receptor for the cytokine interferon gamma (IFNG)
Subcellular Location Cell membrane, Single-pass type I membrane protein
Protein Families Type II cytokine receptor family
Database Links

KEGG: mmu:15979

STRING: 10090.ENSMUSP00000020188

UniGene: Mm.549

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
Necroptosis
Natural killer cell mediated cytotoxicity
Osteoclast differentiation
Th1 and Th2 cell differentiation
Th17 cell differentiation

Related Products

Ifngr1 Proteins

Ifngr1 Proteins for Mus musculus (Mouse)

Ifngr1 ELISA Kit

Ifngr1 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.