Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

Atp1b1

Uniprot No.

P14094

Research Area

Cancer

Species

Mus musculus (Mouse)

Source

in vitro E.coli expression system

Expression Region

1-304aa

Target Protein Sequence

MARGKAKEEGSWKKFIWNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVMLLTISELKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYFGMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECKAYGENIGYSEKDRFQGRFDVKIEIKS-
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

36.7 kDa

Protein Length

Full Length

Tag Info

N-terminal 10xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

I would like to know the denaturation temperature of this subunit.

Denaturation typically occurs around 60°C when heated. Complete denaturation of this protein occurs after treatment in boiling water (100%). Please refer to the current batch's COA for specific details.

Target Background

Function

This is the non-catalytic component of the active enzyme, which catalyzes the hydrolysis of ATP coupled with the exchange of Na(+) and K(+) ions across the plasma membrane. The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane.; Involved in cell adhesion and establishing epithelial cell polarity.

Gene References into Functions

FXYD5 mediates metastatic progression through regulation of the beta Na(+)-K(+)-ATPase subunit in the 4T1 mouse breast cancer model. PMID: 28515087
Activities of AE1 and the sodium pump are coregulated in kidney. PMID: 25012180
Atp1b1 was highly expressed in luminal epithelium during peri-implantation and upregulated by progesterone. PMID: 23534996
Beta(1) is the sole expressed beta-subunit in the diaphragm throughout development, and in the hindlimb muscles at birth. PMID: 12397396
the beta1 subunit of the Na/K-ATPase is required for blastocyst formation and also for maintaining a normal Na/K-ATPase distribution and localization of tight junction-associated polypeptides during preimplantation development PMID: 17317668
These data suggest that CLN3 is involved in the regulation of plasma membrane fodrin cytoskeleton and consequently, the plasma membrane association of Na(+), K(+) ATPase. PMID: 18621045
Inhibition of the Atp1b1 isoenzyme of the sodium potassium exchanging ATPase by 8-methoxycoumestrol is reported. PMID: 19487957
Na,K-beta(1) plays an essential role in regulating cardiac contractility and that its loss is associated with significant pathophysiology of the heart. PMID: 19683723

Hide All

Subcellular Location

Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein. Cell membrane, sarcolemma.

Protein Families

X(+)/potassium ATPases subunit beta family

Tissue Specificity

Expressed in cardiac muscle and in flexor digitorum brevis (FDB) muscle (at protein level). Expressed in a circadian manner in the kidney and aorta (at protein level).

Database Links

KEGG: mmu:11931

STRING: 10090.ENSMUSP00000027863

UniGene: Mm.4550

Message

Product >> Product Name：
Product >> Code：
Name： *
Email： *
Company/Organization：
Phone：
Since emails may get flagged by spam filters occasionally, we recommend leaving your phone number as a precaution. Your information is safe with us.
Question/Comment： *
Your Region： *
I'd like to receive email newsletters from Cusabio

Yes

No
How do you know CUSABIO?

Email

Distributor

Search engine

Advertisement

Others
CAPTCHA verification：
Please enter the characters shown. Click the image to refresh if unclear.

Code	CSB-CF002326MO
Abbreviation	Recombinant Mouse Atp1b1 protein
MSDS	MSDS Datasheet
Size	$1620
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Sodium/potassium-transporting ATPase subunit beta-1 (Atp1b1)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage