Recombinant Pig Cytochrome b-245 heavy chain (CYBB)

Code CSB-CF006325PI
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Uniprot No.
Alternative Names
CYBB; Cytochrome b-245 heavy chain; CGD91-phox; Cytochrome b(558 subunit beta; Cytochrome b558 subunit beta; Heme-binding membrane glycoprotein gp91phox; Neutrophil cytochrome b 91 kDa polypeptide; gp91-1; gp91-phox; p22 phagocyte B-cytochrome; Fragment
Species
Sus scrofa (Pig)
Expression Region
1-484
Target Protein Sequence
STRVRRQLDRNLTFHKMVAWMIALHATIHTIAHLFNVEWCVNARVNNSDPYSIALSDIGD KPNETYLNFVRQRIKNPEGGLYVAVTRLAGITGVVITLCLILIITSSTKTIRRSYFEVFW YTHHLFVIFFIGLAIHGAERIVRRQTPKSLLVHDPKACAQNISQWGKIKDCPIPEFAGNP PMTWKWIVGPMFLYLCERLVRFWRSQQKVVITKVVTHPFKTIELQMKKKGFRMEVGQYIF VKRPAVSKLEWHPFTLTSAPEEDFFSIHIRIVGDWTEGLFKACGCDKQEFQDAWKLPKIA VDGPFGTASEDVFSYQVVMLVGAGIGVTPFASILKSVWYKYCNNATNLRLKKIYFYWLCR DTHAFEWFADLLQLLETQMQERNNAGFLSYNIYLTGWDESQANHFAVHHDEEKDVITGLK QKTLYGRPNWDNEFKTIASQHPTTRIGVFLCGPEALAETLNKQCISNSDSSPRGVHFIFN KENF
Protein Length
Full length protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Critical component of the membrane-bound oxidase of phagocytes that generates superoxide. It is the terminal component of a respiratory chain that transfers single electrons from cytoplasmic NADPH across the plasma membrane to molecular oxygen on the exterior. Also functions as a voltage-gated proton channel that mediates the H(+) currents of resting phagocytes.
Gene References into Functions
  1. These results suggested that resveratrol strongly enhances the RA-induced O2(-)-generating activity via up-regulation of gp91-phox gene expression in U937 cells. PMID: 29183727
  2. sub-vasomotor concentration of ET-1 leads to vascular dysfunction by impairing endothelium-dependent NO-mediated dilation via p38 kinase-mediated production of superoxide from NADPH oxidase following ETA receptor activation PMID: 26211713
  3. activated during ischemia/reperfusion in a complement-dependent manner, and may contribute to the renal damage PMID: 25017967
  4. Reactive oxygen species generated by NADPH oxidase contribute to the aberrant pulmonary arterial responses in piglets exposed to 3 days of hypoxia. PMID: 18757525
  5. Upregulation of PPAR-gamma and NADPH oxidases are involved in restenosis. PMID: 19562688

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1