Recombinant Rat Dipeptidyl peptidase 4(Dpp4),Partial

Code CSB-CF007139RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P14740
Storage Buffer Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Species Rattus norvegicus (Rat)
Sequence SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR
Source in vitro E.coli expression system
Gene Names Dpp4
Protein Names Recommended name: Dipeptidyl peptidase 4 EC= 3.4.14.5Alternative name(s): Bile canaliculus domain-specific membrane glycoprotein Dipeptidyl peptidase IV Short name= DPP IV GP110 glycoprotein T-cell activation antigen CD26 CD_antigen= CD26Cleave
Expression Region 638-767aa
Tag Info 10xHis-SUMO-tag
Protein Description Partial
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.
Subcellular Location Dipeptidyl peptidase 4 soluble form: Secreted, Note=Detected in the serum and the seminal fluid, SUBCELLULAR LOCATION: Cell membrane, Single-pass type II membrane protein, Apical cell membrane, Single-pass type II membrane protein, Cell projection, invadopodium membrane, Single-pass type II membrane protein, Cell projection, lamellipodium membrane, Single-pass type II membrane protein, Cell junction, Membrane raft
Protein Families Peptidase S9B family, DPPIV subfamily
Tissue Specificity Expressed in bile ducts and other epithelial brush borders (small intestine, kidney, colon, pancreatic duct); acinar structures in salivary glands; endothelial structures and T cell areas in thymus, spleen and lymph node.
Database Links

KEGG: rno:25253

STRING: 10116.ENSRNOP00000045536

UniGene: Rn.91364

Pathway Myocardial Fatty Acid Metabolism

Related Products

Dpp4 Antibodies

Dpp4 Antibodies for Rattus norvegicus (Rat)

Dpp4 Proteins

Dpp4 Proteins for Rattus norvegicus (Rat)

Dpp4 ELISA Kit

Dpp4 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.