Code | CSB-EP007139RA |
Size |
US$2466Purchase it in Cusabio online store (only available for customers from the US) |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
Just like other recombinant proteins, the production of this recombinant Rat Dpp4 protein began with appropriate cDNA and PCR methods, and then the Dpp4 expression plasmids were built. Following sequence determination of the constructs, plasmids were transformed into E.coli for the expression of the recombinant Rat Dpp4 protein. N-terminal 6xHis-SUMO tag was used in the process. And we finally get the protein of interest with purity of 90%+. Dpp4 is a gene providing an instruction of making a protein named dipeptidyl peptidase 4 in rattus norvegicus (rat). Dipeptidyl peptidase 4 is also known as bile canaliculus domain-specific membrane glycoprotein, dipeptidyl peptidase IV (DPP IV), GP110 glycoprotein and T-cell activation antigen CD26 (CD26). This protein can be cleaved into 3 chains, including dipeptidyl peptidase 4 membrane form, dipeptidyl peptidase 4 soluble form and dipeptidyl peptidase 4 60 kDa soluble form. It is involved in many biological processes, such as cell adhesion, endothelial cell migration, T cell activation, etc. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Target Names | Dpp4 |
Uniprot No. | P14740 |
Research Area | Immunology |
Alternative Names | Dpp4; Cd26; Dipeptidyl peptidase 4; Bile canaliculus domain-specific membrane glycoprotein; Dipeptidyl peptidase IV; DPP IV; GP110 glycoprotein; T-cell activation antigen CD26; CD antigen CD26 |
Species | Rattus norvegicus (Rat) |
Source | E.coli |
Expression Region | 638-767aa |
Target Protein Sequence | SMVLGSGSGVFKCGIAVAPVSRWEYYDSVYTERYMGLPTPEDNLDHYRNSTVMSRAENFKQVEYLLIHGTADDNVHFQQSAQISKALVDAGVDFQAMWYTDEDHGIASSTAHQHIYSHMSHFLQQCFSLR Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request. |
Mol. Weight | 30.7kDa |
Protein Length | Partial |
Tag Info |
N-terminal 6xHis-SUMO-tagged |
Form |
Liquid or Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Cell surface glycoprotein receptor involved in the costimulatory signal essential for T-cell receptor (TCR)-mediated T-cell activation. Acts as a positive regulator of T-cell coactivation, by binding at least ADA, CAV1, IGF2R, and PTPRC. Its binding to CAV1 and CARD11 induces T-cell proliferation and NF-kappa-B activation in a T-cell receptor/CD3-dependent manner. Its interaction with ADA also regulates lymphocyte-epithelial cell adhesion. In association with FAP is involved in the pericellular proteolysis of the extracellular matrix (ECM), the migration and invasion of endothelial cells into the ECM. May be involved in the promotion of lymphatic endothelial cells adhesion, migration and tube formation. When overexpressed, enhanced cell proliferation, a process inhibited by GPC3. Acts also as a serine exopeptidase with a dipeptidyl peptidase activity that regulates various physiological processes by cleaving peptides in the circulation, including many chemokines, mitogenic growth factors, neuropeptides and peptide hormones. Removes N-terminal dipeptides sequentially from polypeptides having unsubstituted N-termini provided that the penultimate residue is proline.
|
Gene References into Functions |
|
Subcellular Location | [Dipeptidyl peptidase 4 soluble form]: Secreted.; Cell membrane; Single-pass type II membrane protein. Apical cell membrane; Single-pass type II membrane protein. Cell projection, invadopodium membrane; Single-pass type II membrane protein. Cell projection, lamellipodium membrane; Single-pass type II membrane protein. Cell junction. Membrane raft. |
Protein Families | Peptidase S9B family, DPPIV subfamily |
Tissue Specificity | Expressed in bile ducts and other epithelial brush borders (small intestine, kidney, colon, pancreatic duct); acinar structures in salivary glands; endothelial structures and T cell areas in thymus, spleen and lymph node. |
Database Links |
KEGG: rno:25253 STRING: 10116.ENSRNOP00000045536 UniGene: Rn.91364 |