Recombinant Rat Interleukin-6 receptor subunit alpha(Il6r)

Code CSB-CF011665RA
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P22273
Storage Buffer Tris-based buffer,50% glycerol
Species Rattus norvegicus (Rat)
Sequence LVLGSCRALEVANGTVTSLPGATVTLICPGKEAAGNATIHWVYSGSQSREWTTTGNTLVLRAVQVNDTGHYLCFLDDHLVGTVPLLVDVPPEEPKLSCFRKNPLVNAFCEWHPSSTPSPTTKAVMFAKKINTTNGKSDFQVPCQYSQQLKSFSCEVEILEGDKVYHIVSLCVANSVGSRSSHNVVFQSLKMVQPDPPANLVVSAIPGXPRWLKVSWQDPESWDPSYYLLQFELRYRPVWSKXFTVWPLQVAQHQCVIHDALRGVKHVVQVRGKEEFDIGQWSKWSPEVTGTPWLAEPRTTPAGIPGNPTQVSVEDYDNHEDQYGSSTEATSVLAPVQGSSPIPLPTFLVAGGSLAFGLLLCVFIILRLKKKWKSQAEKESKTTSPPPYPLGPLKPTFLLVPLLTPSGSHNSSGTDNTGSHSCLGVRDPQCPNDNSNRDYLFPR
Source in vitro E.coli expression system
Gene Names Il6r
Protein Names Recommended name: Interleukin-6 receptor subunit alpha Short name= IL-6 receptor subunit alpha Short name= IL-6R subunit alpha Short name= IL-6R-alpha Short name= IL-6RA Alternative name(s): IL-6R 1 CD_antigen= CD126
Expression Region 20-462
Tag Info N-terminal 10xHis-tagged
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.
Subcellular Location Membrane, Single-pass type I membrane protein
Protein Families Type I cytokine receptor family, Type 3 subfamily
Database Links

STRING: 10116.ENSRNOP00000028234

UniGene: Rn.1716

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage
Th17 cell differentiation
Inflammatory Pain

Related Products

Il6r Proteins

Il6r Proteins for Rattus norvegicus (Rat)

Il6r ELISA Kit

Il6r ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.