Recombinant Rat Kit ligand (Kitlg)

Code CSB-CF012376RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Kitlg
Uniprot No.
Alternative Names
Kitlg; Kitl; Mgf; Kit ligand; Hematopoietic growth factor KL; Mast cell growth factor; MGF; Stem cell factor; SCF; c-Kit ligand
Species
Rattus norvegicus (Rat)
Expression Region
26-273
Target Protein Sequence
QEICRNPVTDNVKDITKLVANLPNDYMITLNYVAGMDVLPSHCWLRDMVTHLSVSLTTLLDKFSNISEGLSNYSIIDKLGKIVDDLVACMEENAPKNVKESLKKPETRNFTPEEFFSIFNRSIDAFKDFMVASDTSDCVLSSTLGPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAAKSPEDPGLQWTAMALPALISLVIGFAFGALYWKKKQSSLTRAVENIQINEEDNEISMLQQKEREFQEV
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.
Gene References into Functions
  1. the SCF/c-KIT system is aberrantly expressed in varicocele(VC) testis, which could be involved in male infertility caused by VC. PMID: 27707610
  2. It was concluded that the exposure of cadimium on newborn rats ovaries could inhibit follicle development. SCF/c-kit system might mediate follicle development damage caused by cadmium, which is associated with DNA hypomethylation of SCF/c-kit promoter region may be worthy of further study. PMID: 28801138
  3. up-regulation of the NPs/NPR-C and NPs/NPR-A, B/cGMP signaling pathways may be involved in depression-induced loss of gastric ICC by decreasing the production of mSCF PMID: 26862759
  4. Downregulation of either c-kit or CXCR4 in bone marrow stem cells decreased engraftment of circulating bone marrow stem cells and inhibited reparative effects of transmyocardial revascularization. PMID: 25420576
  5. A 100 nM dose of E2 unbalanced the SCF/c-kit system, with a crucial impact on germ cell survival and thus male fertility. PMID: 24825426
  6. SCF/c-kit signaling pathway is required for maintenance of interstitial cells of Cajal phenotype, survival, proliferation, and differentiation. PMID: 24228598
  7. In diabetic colonic dysmotility, deficiency of endogenous IGF-1 in colonic smooth muscle cells leads to reduction of SCF expression. PMID: 23745035
  8. The results of this study concluded that Electroacupuncture treatment up-regulates the positive cells and mRNA expression of SCF after cerebral ischemia/reperfusion. PMID: 22526758
  9. These results suggest that overload training inhibits the phagocytosis and the ROS generation of peritoneal macrophages, and that MGF produced by macrophages may play a key role in this process. PMID: 22592456
  10. activated mature cardiac mast cells are responsible, in a paracrine fashion, for the increase in mature mast cell density post aortocaval fistula by rapidly increasing SCF levels via the release of chymase. PMID: 22850284
  11. Stem cell factor gene transfer induces c-kit(+) stem/progenitor cell expansion in situ and cardiomyocyte proliferation, which may represent a new therapeutic strategy to reverse adverse remodeling after myocardial infarction. PMID: 22931954
  12. results indicate that KL-c-kit interaction plays a role in estrogenic regulation through oocyte-granulosa cell communication PMID: 22366471
  13. Expression of SCF+GM-CSF after hepatectomy can contribute to biliary remodeling (e.g., post-transplantation) by functional deregulation of the activity of key signaling intermediates involved in cell expansion and multipotent differentiation. PMID: 21932404
  14. SCF expression in gastric smooth muscle cells is stimulated by IGF-1 in both dose- and time-dependent manners through IGF-1R in which ERKMAPK signal transduction may play an important role. PMID: 21092510
  15. ability of ghrelin to modulate the expression of the SCF gene PMID: 15284210
  16. SCF released from astrocytes directs neural progenitor cell migration under hypoxic conditions. PMID: 17581219
  17. SCF and its receptor may play a role in the remodelling process of serum nephrotoxic nephritis. PMID: 18087173
  18. Stem cell factor/c-kit signaling mediated cardiac stem cell migration via activation of p38 MAPK. PMID: 18087667
  19. 4-vinylcyclohexene diepoxide compromises KIT/KITL signaling, which is critical for follicular survival in primordial and primary follicles. PMID: 18448842
  20. fetal exposures to DEHP have effects on FLC number, distribution, and most importantly, steroidogenic capacity and abnormal expressions of IGF1, KITL, and LIF genes may contribute to the reproductive toxicity of phthalates PMID: 18469139
  21. Follicle stimulating hormone has a protective effect on germ cells after unilateral testicular torsion, which is reflected by increased SCF expression. PMID: 18544282
  22. postsynaptic RapGAP SPAR is regulated by Polo-like kinase 2 and the SCFbeta-TRCP ubiquitin ligase in hippocampal neurons PMID: 18723513
  23. Upregulation of stem cell factor and c-kit expression occured after spinal cord injury. Stem cell factor could be useful as an agent for treatment of spinal cord injury. PMID: 19182706
  24. mRNA upregulated up to 20-fold in intrahepatic cholangiocarcinoma PMID: 19255573

Show More

Hide All

Subcellular Location
[Isoform 1]: Cell membrane; Single-pass type I membrane protein.; [Isoform 2]: Cytoplasm. Cytoplasm, cytoskeleton. Cell membrane; Single-pass type I membrane protein. Cell projection, lamellipodium. Cell projection, filopodium.; [Soluble KIT ligand]: Secreted.
Protein Families
SCF family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1