Recombinant Rat T-cell-specific surface glycoprotein CD28 (Cd28)

Code CSB-CF004913RA
MSDS
Size Pls inquire
Source in vitro E.coli expression system
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Target Names
Cd28
Uniprot No.
Alternative Names
Cd28; T-cell-specific surface glycoprotein CD28; CD antigen CD28
Species
Rattus norvegicus (Rat)
Expression Region
20-218
Target Protein Sequence
NKILVKQSPLLVVDNNEVSLSCRYSYNLLAKEFRASLYKGVNSDVEVCVGNGNFTYQPQFRPNVGFNCDGNFDNETVTFRLWNLDVNHTDIYFCKIEVMYPPPYLDNEKSNGTIIHIKEKHLCHAQTSPKLFWPLVVVAGVLLCYGLLVTVTLCIIWTNSRRNRLLQSDYMNMTPRRLGPTRKHYQPYAPARDFAAYRP
Protein Length
Full Length of Mature Protein
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production process. If you have specified tag type, please tell us and we will develop the specified tag preferentially.
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer before Lyophilization
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Involved in T-cell activation, the induction of cell proliferation and cytokine production and promotion of T-cell survival. Enhances the production of IL4 and IL10 in T-cells in conjunction with TCR/CD3 ligation and CD40L costimulation.
Gene References into Functions
  1. this study identified two crucial immune-related molecules-CD28 and NFATc1, as putative targets of miR-145 in human and experimental myasthenia gravis PMID: 24043548
  2. CD28 superagonist antibody treatment attenuated obliterative bronchiolitis in rat allo-orthotopic tracheal transplantation by preferentially expanding Foxp3-expressing regulatory T cells. PMID: 22564625
  3. Data demonstrate that the superagonistic monoclonal antibody for CD28, JJ316, preferentially expanded Treg cells. PMID: 21487638
  4. Data show several homologies across human, rat and mouse in the kinetic of loss of several LAgs such as CD5, CD4 and CD28. PMID: 21745657
  5. Tongbi Mixture 2 can inhibit T lymphocytes through down-regulating the expressions of CD28 and CD152. PMID: 18601859
  6. the Th2-response in mercuric chloride-induced autoimmunity requires continuing costimulation via CD28 PMID: 12197880
  7. Data show that superagonists bind to the laterally exposed C"D loop of the immunoglobulin-like domain of CD28 but conventional, costimulatory monoclonal antibodies recognize an epitope close to the binding site for the natural CD80/CD86 ligands. PMID: 12707299
  8. translocation to lipid rafts may play an important role in CD28 signaling. PMID: 15280538
  9. Mechanism for lack of Cbl-b down-regulation may involve the proteasome since blocking proteasomal activity in young T-lymphocytes prevented Cbl-b down regulation while there was no effect in aged T-lymphocytes on Cbl-b expression. PMID: 15491677
  10. CD28 negative T suppressor cells protect allogenic recipients from acute rejection in rats liver transplantation. PMID: 18089392
  11. CD28 superagonists elicit 2 qualitatively distinct waves of activation PMID: 18357346
  12. Targeting the CD28 antigen with a blocking antibody leads to long-term allograft survival by reducing activation of alloantigen-mediated key signaling events in T cells that might be crucial for full T cell activation. PMID: 18408588
  13. CD28 antibody induces donor-specific tolerance in rat renal allografts PMID: 18727698
  14. CD2/CD28 costimulation is the strongest T cell stimulus in vivo in rat lamina propria. PMID: 19811406

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1