Recombinant Mouse Tumor necrosis factor receptor superfamily member 10B(Tnfrsf10b),partial

In Stock
Code CSB-AP005041MO
Product Type Tumor Necrosis Factor
Size US$124
Uniprot No. Q9QZM4
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Tumor necrosis factor receptor superfamily member 10B/Death receptor 5/MK/CD262/Tnfrsf10b/Dr5/Killer
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by its ability to inhibit TRAIL-mediated cytotoxicity using L?929 mouse fibroblast cells treated with TRAIL is less than 1 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence NPAHNRPAGLQRPEESPSRGPCLAGQYLSEGNCKPCREGIDYTSHSNHSLDSCILCTVCKEDKVVETRCNITTNTVCRCKPGTFEDKDSPEICQSCSNCTDGEEELTSCTPRENRKCVSKTAWAS
Research Area Cancer
Source Mammalian cell
Gene Names Tnfrsf10b
Expression Region 53-177aa
Tag Info C-terminal FC-tagged
Mol. Weight 40.9 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
Subcellular Location Membrane, Single-pass type I membrane protein
Tissue Specificity Highly expressed in heart, lung and kidney.
Database Links

KEGG: mmu:21933

STRING: 10090.ENSMUSP00000022663

UniGene: Mm.193430

Pathway p53 signaling pathway
Apoptosis
Necroptosis
Natural killer cell mediated cytotoxicity

Related Products

Tnfrsf10b Proteins

Tnfrsf10b Proteins for Mus musculus (Mouse)

Tnfrsf10b ELISA Kit

Tnfrsf10b ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.