Register | Sign In Professional and Accurate! We are your good partner in biology research.
cusabio

Product Name:

Recombinant Mouse C-X-C motif chemokine 11(Scyb11),partial

Product Type : Recombinant Protein
Code : CSB-RP092874m
Size : Pls inquiry other sizes
Uniprot NO. : Q9JHH5
Storage : The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Relevance : Chotactic for interleukin-activated T-cells but not unstimulated T-cells, neutrophils or monocytes. Induces calcium release in activated T-cells. Binds to CXCR3. May play an important role in CNS diseases which involve T-cell recruitment. May play a role in skin immune responses .
References : The murine chemokine CXCL11 (IFN-inducible T cell alpha chemoattractant) is an IFN-gamma- and lipopolysaccharide-inducible glucocorticoid-attenuated response gene expressed in lung and other tissues during endotoxemia.Widney D.P., Xia Y.-R., Lusis A.J., Smith J.B.J. Immunol. 164:6322-6331(2000)
Storage Buffer : Tris-based buffer,50% glycerol
Alias : Interferon-inducible T-cell alpha chemoattractant ;I-TACSmall-inducible cytokine B11
Species : Mus musculus (Mouse)
Purity : Greater than 90% as determined by SDS-PAGE.
Sequence : FLMFKQGRCLCIGPGMKAVKMAEIEKASVIYPSNGCDKVEVIVTMKAHKRQRCLDPRSKQARLIMQAIEKKNFLRRQ
Research Area : Others
Source : E.coli
Gene Names : Scyb11
Expression Region : 22-98aa
Notes : Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Product Info :
Mol. Weight : 12.9kDa
Protein Description : Partial
Contact us
Copyright © 2007-2015 www.cusabio.com Cusabio Biotech Co., Ltd All Rights Reserved.