Recombinant Human Erythropoietin(EPO) (Active)

In Stock
Code CSB-AP003571HU
Product Type Colony Stimulating Factor
Size $91Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P01588
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Erythropoietin; Epoetin; EPO
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using TF?1 human erythroleukemic cells is less than 5 ng/ml
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
Research Area Signal Transduction
Source Mammalian cell
Gene Names EPO
Expression Region 28-193aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 19.2 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function Hormone involved in the regulation of erythrocyte proliferation and differentiation and the maintenance of a physiological level of circulating erythrocyte mass. Binds to EPOR leading to EPOR dimerization and JAK2 activation thereby activating specific downstream effectors, including STAT1 and STAT3.
Involvement in disease Microvascular complications of diabetes 2 (MVCD2)
Subcellular Location Secreted
Protein Families EPO/TPO family
Tissue Specificity Produced by kidney or liver of adult mammals and by liver of fetal or neonatal mammals.
Database Links

HGNC: 3415

OMIM: 133170

KEGG: hsa:2056

STRING: 9606.ENSP00000252723

UniGene: Hs.2303

Pathway HIF-1 signaling pathway
Jak-STAT signaling pathway
PI3K-Akt signaling pathway
Hematopoietic cell lineage

Related Products

EPO Antibodies

EPO Antibodies for Homo sapiens (Human)

EPO Antibodies for Human

EPO Proteins

EPO Proteins for Homo sapiens (Human)

EPO ELISA Kit

EPO ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.