Recombinant Human Fibroblast growth factor 2 (FGF2) (Active)

In Stock
Code CSB-AP003841HU
Abbreviation Recombinant Human FGF2 protein (Active)
MSDS
Size $96
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-2.0 ng/ml.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Basic fibroblast growth factor; Basic fibroblast growth factor bFGF; BFGF; FGF 2; FGF B; FGF-2; Fgf2; FGF2 basic; FGF2_HUMAN; FGFB; Fibroblast growth factor 2 (basic); Fibroblast growth factor 2; Fibroblast growth factor; basic; HBGF 2; HBGF-2; HBGF2; HBGH 2; HBGH2; Heparin binding growth factor 2 precursor; Heparin-binding growth factor 2; Prostatropin
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
143-288aa
Complete Sequence
PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Mol. Weight
16.3 kDa
Protein Length
Full Length of Mature Protein of Isoform 1
Tag Info
Tag-Free
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20mM Tris-HCl, 100mM NaCl, 0.02% Tween80, pH 7.5.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*