Home
Active Protein
Growth Factor
Recombinant Human Fibroblast growth factor 2 (FGF2) (Active)

Recombinant Human Fibroblast growth factor 2 (FGF2) (Active)

^{In Stock}

Code	CSB-AP003841HU
Abbreviation	Recombinant Human FGF2 protein (Active)
MSDS	MSDS Datasheet
Size	$96
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 0.01 EU/µg as determined by LAL method.

Activity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 0.3-2.0 ng/ml.

Target Names

FGF2

Uniprot No.

P09038-4

Research Area

Signal Transduction

Alternative Names

Basic fibroblast growth factor; Basic fibroblast growth factor bFGF; BFGF; FGF 2; FGF B; FGF-2; Fgf2; FGF2 basic; FGF2_HUMAN; FGFB; Fibroblast growth factor 2 (basic); Fibroblast growth factor 2; Fibroblast growth factor; basic; HBGF 2; HBGF-2; HBGF2; HBGH 2; HBGH2; Heparin binding growth factor 2 precursor; Heparin-binding growth factor 2; Prostatropin

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

143-288aa

Complete Sequence

PALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Mol. Weight

16.3 kDa

Protein Length

Full Length of Mature Protein of Isoform 1

Tag Info

Tag-Free

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20mM Tris-HCl, 100mM NaCl, 0.02% Tween80, pH 7.5.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.

Description

FGF2 drives angiogenesis, wound healing, and stem cell self-renewal through potent activation of FGFR1–4, making it indispensable in both basic signaling research and translational models. This tag-free recombinant human FGF2 covers the full mature sequence of isoform 1 (aa 143–288), expressed in *E. coli*—an appropriate system given that native FGF2 is non-glycosylated, ensuring biologically relevant folding without post-translational variability. Validated activity yields an ED50 of 0.3–2.0 ng/mL in BALB/c 3T3 proliferation assays, confirming receptor-binding potency suitable for cell proliferation and survival studies, pluripotent stem cell maintenance, neuronal or osteogenic differentiation protocols, and angiogenesis or wound healing models. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for receptor-ligand binding assays via SPR or ELISA, as well as sensitive *in vivo* regenerative medicine applications.