Home
Active Protein
Growth Factor
Recombinant Human Fibroblast growth factor 2 (FGF2), partial (Active)

Recombinant Human Fibroblast growth factor 2 (FGF2), partial (Active)

^{In Stock}

Code	CSB-AP003751HU
MSDS	MSDS
Size	$96
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 0.01 EU/µg as determined by LAL method.

Activity

The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is 1.11 ng/ml.

Target Names

FGF2

Uniprot No.

P09038-4

Research Area

Signal Transduction

Alternative Names

Basic fibroblast growth factor; Basic fibroblast growth factor bFGF; BFGF; FGF 2; FGF B; FGF-2; Fgf2; FGF2 basic; FGF2_HUMAN; FGFB; Fibroblast growth factor 2 (basic); Fibroblast growth factor 2; Fibroblast growth factor; basic; HBGF 2; HBGF-2; HBGF2; HBGH 2; HBGH2; Heparin binding growth factor 2 precursor; Heparin-binding growth factor 2; Prostatropin

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

132-288aa

Complete Sequence

GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Mol. Weight

17.4 kDa

Protein Length

Partial of Isoform 1

Tag Info

Tag-Free

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20mM Tris, 150mM NaCl, 3% Trehalose, 4% Mannitol, pH 7.5

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.