Recombinant Human Fibroblast growth factor 2(FGF2),partial

In Stock
Code CSB-AP003751HU
Product Type Growth Factor
Size US$65
Uniprot No. P09038
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 7.5
Alias Fibroblast Growth Factor 2; FGF-2; Basic Fibroblast Growth Factor; bFGF; Heparin-Binding Growth Factor 2; HBGF-2; FGF2; FGFB
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 10 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence GTMAAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Research Area Signal Transduction
Source E.coli
Gene Names FGF2
Expression Region 132-288aa
Tag Info Tag-Free
Mol. Weight 17.4 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in the regulation of cell survival, cell division, angiogenesis, cell differentiation and cell migration. Functions as potent mitogen in vitro. Can induce angiogenesis
Subcellular Location Secreted, Nucleus
Protein Families Heparin-binding growth factors family
Tissue Specificity Expressed in granulosa and cumulus cells. Expressed in hepatocellular carcinoma cells, but not in non-cancerous liver tissue.
Database Links

HGNC: 3676

OMIM: 134920

KEGG: hsa:2247

STRING: 9606.ENSP00000264498

UniGene: Hs.284244

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Ras signaling pathway
Signaling pathways regulating pluripotency of stem cells
Rap1 signaling pathway

Related Products

FGF2 Antibodies

FGF2 Antibodies for Homo sapiens (Human)

FGF2 Antibodies for Human

FGF2 Proteins

FGF2 Proteins for Homo sapiens (Human)

FGF2 ELISA Kit

FGF2 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.