Recombinant Human Fibroblast growth factor 4 (FGF4), partial (Active)

In Stock
Code CSB-AP003981HU
Abbreviation Recombinant Human FGF4 protein, partial (Active)
MSDS
Size $204
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined in a cell proliferation assay using MCF7 Human breast cancer cells is 2-20 ng/ml.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
FGF-4; Fgf4; FGF4_HUMAN; Fibroblast growth factor 4; fibroblast growth factor 4 splice isoform; HBGF-4; HBGF4; Heparin secretory-transforming protein 1; Heparin-binding growth factor 4; Hst; HST-1; HST1; HSTF-1; HSTF1; Human stomach cancer transforming factor from FGF related oncogene; K FGF; Kaposi Sarcoma Oncogene; KFGF; KS3; Oncogene HST; Transforming protein KS3
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
54-206aa
Complete Sequence
SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Mol. Weight
16.9 kDa
Protein Length
Partial
Tag Info
Tag-Free
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered PBS, 500mM NaCl, pH7.4.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

FGF4 drives mitogenic signaling through FGFR complexes and plays critical roles in embryonic development, angiogenesis, and tumor progression. This tag-free recombinant human FGF4 (residues 54–206) covers the mature secreted form and demonstrates potent bioactivity with an ED50 of 2–20 ng/ml in MCF7 cell proliferation assays, confirming receptor-binding competence suitable for cell survival studies, angiogenesis models, and stem cell differentiation experiments. Produced in *E. coli*, the protein lacks glycosylation, making it appropriate for receptor-ligand binding and competition assays—such as SPR or ELISA—where consistent, homogeneous preparations are essential for quantitative reproducibility. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the criteria typical for sensitive cell-based assays and supports use in tumor biology models or as a reliable standard in antibody characterization workflows.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.
Gene References into Functions
  1. our study demonstrated that FGFR4 rs2011077 and rs1966265 are associated with the progression of cervical normal tissues to precancerous lesions in Taiwanese women. Moreover, rs351855 (Gly388Arg) is the only FGFR4 genetic polymorphism that is associated with patient survival. PMID: 28378614
  2. Thus, we conclude that the oncoprotein HBXIP up-regulates FGF4 through activating transcriptional factor Sp1 to promote the migration of breast cancer cells. Therapeutically, HBXIP may serve as a novel target in breast cancer. PMID: 26828265
  3. Fibroblasts induce expression of FGF4 in ovarian cancer stem-like cells/cancer-initiating cells and upregulate their tumor initiation capacity. PMID: 25329002
  4. Data show that the interaction between Artd1 and Sox2 is crucial for the first steps of the reprogramming process and that early expression of Fgf4 is an essential component for the successful generation of iPSCs. PMID: 23939864
  5. Myoblasts which overexpress FGF-4 exhibit significant changes in cell cycle and pro-angiogenic potential with only slight differences in the expression of the myogenic genes. PMID: 21673370
  6. In vivo stimulation of BT-474 cell growth by progesterone is associated with up-regulation of FGF4 which may promote tumor growth and maintenance. PMID: 22237711
  7. knockdown of FGFR4 expression led to decreased proliferation and an increased rate of apoptosis in the MKN45 and SGC7901 GC cell lines PMID: 21567388
  8. activation of human HST-1 gene in transgenic mice induces spermatogenesis and prevents adriamycin-induced testicular toxicity PMID: 11840335
  9. Differential effects of FGF4, EGF and TGFB1 on functional development of stromal layers (progenitor cell-outputs) in acute myeloid leukemia PMID: 12163055
  10. FGF4 is upregulated by the OCT3 transcription factor in breast cancer cells. PMID: 12841847
  11. HST-1 protects male germ cells from apoptosis under heat-stress condition in a mouse model. PMID: 14980503
  12. Both myeov and hst (fgf4) are normally situated approximately 475-kb apart at band 11q13, a region that is frequently amplified and overexpressed in various tumours. PMID: 17390055
  13. FGF-4 increases the rate at which MSC proliferate and has no significant effect on MSC pluripotency PMID: 17852409
  14. These results suggest a growth-promoting role for FGF4 in human embryonic stem cells and a putative feedback inhibition mechanism by a novel FGF4 splice isoform that may serve to promote differentiation at later stages of development. PMID: 18192227
  15. Implantation of human FGF4-soaked beads is sufficient to restore expression of G1- and S-phase cell-cycle genes and S-phase progression in zebrafish sonic hedgehog (Shh) mutant fin buds. PMID: 18811955
  16. The combined action of retinoic acid and FGF4 results in induction of PDX1+ foregut endoderm. PMID: 19277121

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
Heparin-binding growth factors family
Database Links

HGNC: 3682

OMIM: 164980

KEGG: hsa:2249

STRING: 9606.ENSP00000168712

UniGene: Hs.1755

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*