Recombinant Human Fibroblast growth factor 4(FGF4),partial

In Stock
Code CSB-AP003981HU
Product Type Growth Factor
Size US$137
Uniprot No. P08620
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Fibroblast growth factor 4; FGF-4; Heparin secretory-transforming protein 1; HST; HST-1; HSTF-1; Heparin-binding growth factor 4; HBGF-4; Transforming protein KS3; FGF4; HST; HSTF1; KS3
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined in a cell proliferation assay using BALB/c 3T3 cells is less than 10 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SLARLPVAAQPKEAAVQSGAGDYLLGIKRLRRLYCNVGIGFHLQALPDGRIGGAHADTRDSLLELSPVERGVVSIFGVASRFFVAMSSKGKLYGSPFFTDECTFKEILLPNNYNAYESYKYPGMFIALSKNGKTKKGNRVSPTMKVTHFLPRL
Research Area Signal Transduction
Source E.coli
Gene Names FGF4
Expression Region 54-206aa
Tag Info Tag-Free
Mol. Weight 16.9 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Plays an important role in the regulation of embryonic development, cell proliferation, and cell differentiation. Required for normal limb and cardiac valve development during embryogenesis.
Subcellular Location Secreted
Protein Families Heparin-binding growth factors family
Database Links

HGNC: 3682

OMIM: 164980

KEGG: hsa:2249

STRING: 9606.ENSP00000168712

UniGene: Hs.1755

Pathway MAPK signaling pathway
PI3K-Akt signaling pathway
Regulation of actin cytoskeleton
Ras signaling pathway
Rap1 signaling pathway

Related Products

FGF4 Antibodies

FGF4 Antibodies for Homo sapiens (Human)

FGF4 Proteins

FGF4 Proteins for Homo sapiens (Human)

FGF4 ELISA Kit

FGF4 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.