Recombinant Human Leukemia inhibitory factor(LIF)

In Stock
Code CSB-AP004001HU
Product Type Growth Factor
Size $137Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. P15018
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, 0.02% Tween 20, pH 7.4
Alias Leukemia Inhibitory Factor; LIF; Differentiation-Stimulating Factor; D Factor; Melanoma-Derived LPL Inhibitor; MLPLI; Emfilermin; LIF; HILDA
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by the M1 cell differentiation assay is less than 0.8 ng/ml
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
Research Area Cancer
Source E.coli
Gene Names LIF
Expression Region 23-202aa
Tag Info Tag-Free
Mol. Weight 19.7 kDa
Protein Description Full Length of Mature Protein
Still Have Questions? Leave a Message or Start an on-line Chat
Function LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
Subcellular Location Secreted
Protein Families LIF/OSM family
Database Links

HGNC: 6596

OMIM: 159540

KEGG: hsa:3976

STRING: 9606.ENSP00000249075

UniGene: Hs.2250

Pathway Jak-STAT signaling pathway
TNF signaling pathway
Signaling pathways regulating pluripotency of stem cells
Excitatory synapse pathway

Related Products

LIF Antibodies

LIF Antibodies for Human

LIF Antibodies for Homo sapiens (Human)

LIF Proteins

LIF Proteins for Homo sapiens (Human)

LIF ELISA Kit

LIF ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.