Code | CSB-MP012928HUd9 |
Size | $368 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
CUSABIO expresses the gene fragment encoding amino acid residues 23-202 of the human Leukemia inhibitory factor (LIF) in mammalian cells. The hFc tag is fused to the C-terminus of the resulting protein, producing the recombinant human LIF protein. This recombinant protein is an active protein and its bioactivity has been validated in a functional ELISA through its binding with human LIFR. Its purity is greater than 90% determined by SDS-PAGE. It migrated to the molecular weight band of approximately 60 kDa on the gel. And its endotoxin is less than 1.0 EU/ug measured by the LAL method. The target protein LIF is a multi-functional cytokine, which binds to the LIFR and then recruits gp130 to form a high-affinity receptor complex to induce the activation of the downstream signal pathways, including JAK/STAT3, PI3K/AKT, ERK1/2, and mTOR signaling. It exerts broad biological functions in neuronal, hepatic, endocrine, inflammatory, and immune systems. It plays a role in repressing the growth of leukemia cells but promotes the development and progression of many types of solid tumors. |
Purity | Greater than 90% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized human LIF at 2 μg/ml can bind human LIFR (CSB-MP012929HUi9), the EC50 is 22.58-30.24 ng/ml. |
Target Names | LIF |
Uniprot No. | P15018 |
Research Area | Cancer |
Alternative Names | (LIF)(Differentiation-stimulating factor)(D factor)(Melanoma-derived LPL inhibitor)(MLPLI)(Emfilermin) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 23-202aa |
Target Protein Sequence | SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF |
Mol. Weight | 48.6 kDa |
Protein Length | Full Length of Mature Protein |
Tag Info |
C-terminal hFc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
LIF has the capacity to induce terminal differentiation in leukemic cells. Its activities include the induction of hematopoietic differentiation in normal and myeloid leukemia cells, the induction of neuronal cell differentiation, and the stimulation of acute-phase protein synthesis in hepatocytes.
|
Gene References into Functions |
|
Subcellular Location | Secreted. |
Protein Families | LIF/OSM family |
Database Links |
HGNC: 6596 OMIM: 159540 KEGG: hsa:3976 STRING: 9606.ENSP00000249075 UniGene: Hs.2250 |