Recombinant Human Leukocyte surface antigen CD47(CD47),partial

In Stock
Code CSB-AP005201HU
Product Type Immune Checkpoint
Size US$104
Uniprot No. Q08722
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 10 mM Tris-Citrate, 150 mM NaCl, 5% Mannitol, pH 8.0
Alias Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human SIRPA in functional ELISA is less than 20 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Research Area Immunology
Source Mammalian cell
Gene Names CD47
Expression Region 19-139aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 14.76 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
Subcellular Location Cell membrane, Multi-pass membrane protein
Tissue Specificity Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain.
Database Links

HGNC: 1682

OMIM: 601028

KEGG: hsa:961

STRING: 9606.ENSP00000355361

UniGene: Hs.446414

Related Products

CD47 Antibodies

CD47 Antibodies for Homo sapiens (Human)

CD47 Antibodies for Human

CD47 Proteins

CD47 Proteins for Mus musculus (Mouse)

CD47 Proteins for Sus scrofa (Pig)

CD47 Proteins for Bos taurus (Bovine)

CD47 Proteins for Rattus norvegicus (Rat)

CD47 Proteins for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

CD47 cDNA

CD47 cDNA for Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)

CD47 cDNA for Sus scrofa (Pig)

CD47 ELISA Kit

CD47 ELISA Kit for Homo sapiens (Human)

CD47 ELISA Kit for Mus musculus (Mouse)

CD47 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.