Code | CSB-MP004940HU |
Size | $428 |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
Recombinant human leukocyte surface antigen CD47 carrying a C-terminal hFc-tag is a partial-length protein expressed in mammalian cells. The DNA fragment used to prepare this recombinant protein corresponds to amino acid residues Gln19-Pro139 of human CD47 protein. Its purity is greater than 93% determined by SDS-PAGE. A molecular mass band of approximately 55 kDa was visualized on the gel. The endotoxin of this recombinant CD47 protein is less than 1.0 EU/ug measured by the LAL method. It has been validated as an active protein. In the function ELISA, this CD47 protein can bind to the immobilized SIRPA, with an EC50 of 65.91-82.42 ng/ml. In the LSPR assay, this CD47 protein binds to the human SIRPA protein captured on the COOH chip with an affinity constant of 19.2 nM. And it is available now. CD47, also called IAP, is a widely expressed cell surface receptor with multiple immunoregulatory functions. Upon engagement with its ligands such as TSP-1, SIRPα, or SHPS-1, CD47 modulates numerous immune responses, including cellular phagocytosis by macrophages, transmigration of neutrophils, and activation of dendritic cells, T cells, and B cells, as well as proliferation, apoptosis, and adhesion. |
Purity | Greater than 93% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | ①Measured by its binding ability in a functional ELISA. Immobilized SIRPA (CSB-MP021334HU) at 2 μg/ml can bind human CD47, the EC50 of human CD47 protein is 65.91-82.42 ng/ml.②Human SIRPA protein His/Myc tag (CSB-MP021334HU) captured on COOH chip can bind Human CD47 protein Fc tag (CSB-MP004940HU) with an affinity constant of 19.1 nM as detected by LSPR Assay. |
Target Names | CD47 |
Uniprot No. | Q08722 |
Research Area | Cancer |
Alternative Names | Antigenic surface determinant protein OA3(Integrin-associated protein)(IAP)(Protein MER6)(CD47) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 19-139aa |
Target Protein Sequence | QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP |
Mol. Weight | 41.5 kDa |
Protein Length | Partial |
Tag Info |
C-terminal hFc-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | 3-7 business days |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Multi-pass membrane protein. |
Tissue Specificity | Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain. |
Database Links |
HGNC: 1682 OMIM: 601028 KEGG: hsa:961 STRING: 9606.ENSP00000355361 UniGene: Hs.446414 |