Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized SIRPA (CSB-MP021334HU) at 2 μg/ml can bind human CD47, the EC50 of human CD47 protein is 65.91-82.42 ng/ml.②Human SIRPA protein His/Myc tag (CSB-MP021334HU) captured on COOH chip can bind Human CD47 protein Fc tag (CSB-MP004940HU) with an affinity constant of 19.1 nM as detected by LSPR Assay.
Alternative Names
Antigenic surface determinant protein OA3(Integrin-associated protein)(IAP)(Protein MER6)(CD47)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
19-139aa
Target Protein Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Tag Info
C-terminal hFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Recombinant human leukocyte surface antigen CD47 carrying a C-terminal hFc-tag is a partial-length protein expressed in mammalian cells. The DNA fragment used to prepare this recombinant protein corresponds to amino acid residues Gln19-Pro139 of human CD47 protein. Its purity is greater than 90% determined by SDS-PAGE. A molecular mass band of approximately 55 kDa was visualized on the gel. The endotoxin of this recombinant CD47 protein is less than 1.0 EU/ug measured by the LAL method. It has been validated as an active protein. In the function ELISA, this CD47 protein can bind to the immobilized SIRPA, with an EC50 of 65.91-82.42 ng/ml. In the LSPR assay, this CD47 protein binds to the human SIRPA protein captured on the COOH chip with an affinity constant of 19.2 nM. And it is available now.
CD47, also called IAP, is a widely expressed cell surface receptor with multiple immunoregulatory functions. Upon engagement with its ligands such as TSP-1, SIRPα, or SHPS-1, CD47 modulates numerous immune responses, including cellular phagocytosis by macrophages, transmigration of neutrophils, and activation of dendritic cells, T cells, and B cells, as well as proliferation, apoptosis, and adhesion.