Recombinant Human Leukocyte surface antigen CD47 (CD47), partial, Biotinylated

Code CSB-MP004940HU-B
MSDS
Size $428
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • The purity of CD47 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Not Test
Target Names
CD47
Uniprot No.
Research Area
Cancer
Alternative Names
Antigenic surface determinant protein OA3;Integrin-associated protein;IAP;Protein MER6;CD antigen CD47
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-139aa
Target Protein Sequence
QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight
43.3 kDa
Protein Length
Partial
Tag Info
C-terminal hFC-Avi-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus. Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
Gene References into Functions
  1. results suggest that cancers can evolve SE to drive CD47 overexpression to escape immune surveillance PMID: 28378740
  2. overexpression of human CD200 in donor pigs could constitute a promising strategy for overcoming xenograft rejection. PMID: 28968355
  3. High CD47 expression is associated with the increase in the ability of surviving breast cancer cells to evade innate and adaptive immunity. PMID: 29367423
  4. CD47 expression is decreased on the surface of erythrocytes in obese subjects. These changes in CD47 expression on the erythrocytes surface may be an adaptive response to hyperfibrinogenemia associated with obesity. PMID: 25914268
  5. Results show that the thrombospondin 1 (TSP1) and its receptor CD47 (CD47) axis selectively regulates NADPH oxidase 1 (Nox1) in the regulation of endothelial senescence and suggest potential targets for controlling the aging process at the molecular level. PMID: 29042481
  6. CD47 is overexpressed in primary non-small cell lung cancer (NSCLC) tissues and cell lines, suggesting that CD47 is a promising therapeutic target for NSCLC. PMID: 27411490
  7. Among the various candidate genes involved in acute rejection, CD47 inhibits monocyte/macrophage-mediated phagocytosis by identifying the CD47 signal regulatory protein alpha (SIRP-alpha) as self/non-self. Tissue factor pathway inhibitor (TFPI) is involved in the regulation of the coagulation pathway and is able to bind to another ligand of CD47, thrombospondin-1 (TSP-1). PMID: 28393401
  8. Blocking CD47 using antibodies could efficiently induce macrophage-mediated phagocytosis of tumor cells and treat cancers. PMID: 27863402
  9. High CD47 expression is not associated with Fibrolamellar Hepatocellular Carcinoma. PMID: 28801364
  10. TTI-621 (SIRPalphaFc) is a fully human recombinant fusion protein that blocks the CD47-SIRPalpha axis by binding to human CD47 and enhancing phagocytosis of malignant cells..These data indicate that TTI-621 is active across a broad range of human tumors. PMID: 27856600
  11. this review highlights the various functions of CD47, discusses anti-tumor responses generated by both the innate and adaptive immune systems as a consequence of administering anti-CD47 blocking antibody, and finally elaborates on the clinical potential of CD47 blockade. PMID: 28077173
  12. we observed neutrophilic infiltration was slightly increased in anti-CD47 treated tumors compared to IgG control. PMID: 28100392
  13. In pulmonary hypertension TSP1-CD47 is upregulated, and contributes to pulmonary arterial vasculopathy and dysfunction. PMID: 27742621
  14. thrombospondin-1 via CD47 inhibits renal tubular epithelial cell recovery after ischemia reperfusion injury through inhibition of proliferation/self-renewal. PMID: 27259369
  15. Engineering macrophages to eat cancer: from "marker of self" CD47 and phagocytosis to differentiation PMID: 28522599
  16. the results obtained by combining bioinformatics and preclinical studies strongly suggest that targeting TSP-1/CD47 axis may represent a valuable therapeutic alternative for hampering melanoma spreading. PMID: 27349907
  17. Results indicated that surgical resection combined with anti-CD47 blocking immunotherapy promoted an inflammatory response and prolonged survival in xenograft animal model, and is therefore an attractive strategy for clinical translation. PMID: 28076333
  18. Results show that the stronger expression of CD47 by cancer cells and larger number of total macrophages/M2 were independently related to shorter survivals. PMID: 27322955
  19. Prolongation of transient porcine chimerism via transgenic expression of human CD47 in a primate model is associated with an immune modulating effect, leading to markedly prolonged survival of donor swine skin xenografts. PMID: 27232934
  20. CD47 is a promising cancer biomarker, and targeting CD47 presents an effective and potential therapeutic strategy through synthesized mechanisms PMID: 26446381
  21. CD47 seems to mediate fusion mostly through broad contact surfaces between the partners' cell membrane while syncytin-1 mediate fusion through phagocytic-cup like structure. PMID: 27714815
  22. The results suggested a critical role of CD47 in laryngeal squamous cell carcinoma development. PMID: 27855370
  23. Data show that anti-human CD47 antibody B6H12 decreased expression of epidermal growth factor receptor (EGFR) and the stem cell transcription factors. PMID: 26840086
  24. suggest that microglial activation may be partially caused by CD47/signal regulatory protein-alpha- and CD200/CD200R-mediated reductions in the immune inhibitory pathways PMID: 27095555
  25. Our results highlight an underappreciated contribution of the adaptive immune system to anti-CD47 adjuvant therapy and suggest that targeting both innate and adaptive immune checkpoints can potentiate the vaccinal effect of antitumor antibody therapy. PMID: 27091975
  26. Data suggest a reduction in the CD47 antigen/signal-regulatory protein alpha (SIRPalpha) pathway by programmed cell death protein 1 (PD-1) blockade, which regulates Myeloid-derived suppressor cells (MDSCs) and tumor associated macrophages (TAMs). PMID: 26573233
  27. atherogenesis is associated with upregulation of CD47, a key anti-phagocytic molecule that is known to render malignant cells resistant to programmed cell removal, or 'efferocytosis' PMID: 27437576
  28. CD47 is a critical regulator in the metastasis of osteosarcoma and results suggest that targeted inhibition of this antigen by anti-CD47 may be a novel immunotherapeutic approach in the management of this tumor. PMID: 26093091
  29. agents that block the CD47:SIRP-alpha engagement are attractive therapeutic targets as a monotherapy or in combination with additional immune-modulating agents for activating antitumor T cells in vivo PMID: 26116271
  30. CD47 is an adverse prognostic factor and promising therapeutic target in gastric cancer. PMID: 26077800
  31. study demonstrates that antigen-presenting cells(CD47+) in coculture with human macrophages show a CD47 concentration-dependent inhibition of phagocytosis PMID: 25593301
  32. CD47 expression contributes to the lethal breast cancer phenotype that is mediated by HIF-1. PMID: 26512116
  33. CD47 is highly expressed on cancer stem cells, but not on other nonmalignant cells in the pancreas. PMID: 25717063
  34. CD47 mediates signaling from the extracellular matrix that coordinately regulates basal metabolism and cytoprotective responses to radiation injury PMID: 26311851
  35. CD47 has a central role in hydrogen sulfate biosynthesis, regulation and signaling in T cells. PMID: 25747479
  36. Loss of cell surface CD47 clustering formation and binding avidity to SIRPalpha facilitate apoptotic cell clearance by macrophages. PMID: 26085683
  37. While CD47 expression on circulating AML blasts has been shown to be a negative prognostic marker for a very defined population of AML patients with NK AML, CD47 expression on AML BM blasts is not PMID: 25943033
  38. Velcro" engineering of high affinity CD47 ectodomain as signal regulatory protein alpha (SIRPalpha) antagonists that enhance antibody-dependent cellular phagocytosis PMID: 25837251
  39. during translation of CD47, the scaffold function of the 3' UTR facilitates binding of proteins to nascent proteins, to direct their transport or function--and this role of 3' UTRs can be regulated by polyadenylation PMID: 25896326
  40. Report poor prognosis/survival in luminal breast cancer patients with circulating tumor cells co-expressing MET and CD47. PMID: 25230070
  41. Staphylococcal SElX and SSL6 proteins bind cell surface receptors PSGL-1 and CD47, respectively. PMID: 24840181
  42. The thrombospondin-1 receptor CD47 directly or indirectly regulates intercellular communication mediated by the transfer of extracellular vesicles between vascular cells. PMID: 24887393
  43. expression is induced following EBV infection of B cells; ligation cases G1 arres PMID: 24911792
  44. CD47 regulates the epigenetic code by targeting UHRF1. PMID: 25550546
  45. Elevated postinjury thrombospondin 1-CD47 triggering aids differentiation of patients' defective inflammatory CD1a+dendritic cells. PMID: 25001859
  46. the TSP-derived 4N1K peptide effects on cell adhesion and integrin activation are independent of CD47 PMID: 24848268
  47. CD47 associates with and regulates VEGFR2 in T cells. CD47 signaling modulates the ability of VEGF to regulate proliferation and TCR signaling, and autocrine production of vascular endothelial growth factor by T cells contributes to this regulation. PMID: 25200950
  48. Suppression of CD47 by morpholino approach suppressed growth of hepatocellular carcinoma in vivo and exerted a chemosensitization effect through blockade of CTSS/PAR2 signaling. PMID: 24523067
  49. CD47 plays the pivotal role in the immune evasion of primary effusion lymphoma cells in body cavities. Therapeutic antibody targeting of CD47 could be an effective therapy for PEL. PMID: 24726056
  50. Data indicate that CD47 in cis interactions regulate LFA-1 (integrin alphaLbeta2) and VLA-4 (integrin alpha4beta1) integrin affinity, and this process plays a substantial role in the adhesion of T-cells. PMID: 24006483

Show More

Hide All

Subcellular Location
Cell membrane; Multi-pass membrane protein.
Tissue Specificity
Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain.
Database Links

HGNC: 1682

OMIM: 601028

KEGG: hsa:961

STRING: 9606.ENSP00000355361

UniGene: Hs.446414

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*