Recombinant Human Leukocyte surface antigen CD47(CD47),partial (Active)

In Stock
Code CSB-AP005211HU
Size US$3564Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Activity The ED50 as determined by its ability to bind Human SIRPA in functional ELISA is less than 200 ng/ml.
Target Names CD47
Uniprot No. Q08722
Research Area Immunology
Alternative Names Antigen identified by monoclonal 1D8; Antigenic surface determinant protein OA3; CD 47; CD47; CD47 antigen (Rh-related antigen; integrin-associated signal transducer); CD47 antigen; CD47 glycoprotein; CD47 molecule; CD47_HUMAN; IAP; Integrin Associated Protein; Integrin associated signal transducer; Integrin-associated protein; Leukocyte surface antigen CD47; MER 6; MER6; OA 3; OA3; OTTHUMP00000041152; OTTHUMP00000041153; Protein MER6; Rh related antigen; Surface antigen identified by monoclonal 1D8
Species Homo sapiens (Human)
Source Mammalian cell
Expression Region 19-139aa
Complete Sequence QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Mol. Weight 40.8 kDa
Protein Length Partial
Tag Info C-terminal FC-tagged
Form Lyophilized powder
Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
Gene References into Functions
  1. results suggest that cancers can evolve SE to drive CD47 overexpression to escape immune surveillance PMID: 28378740
  2. overexpression of human CD200 in donor pigs could constitute a promising strategy for overcoming xenograft rejection. PMID: 28968355
  3. High CD47 expression is associated with the increase in the ability of surviving breast cancer cells to evade innate and adaptive immunity. PMID: 29367423
  4. CD47 expression is decreased on the surface of erythrocytes in obese subjects. These changes in CD47 expression on the erythrocytes surface may be an adaptive response to hyperfibrinogenemia associated with obesity. PMID: 25914268
  5. Results show that the thrombospondin 1 (TSP1) and its receptor CD47 (CD47) axis selectively regulates NADPH oxidase 1 (Nox1) in the regulation of endothelial senescence and suggest potential targets for controlling the aging process at the molecular level. PMID: 29042481
  6. CD47 is overexpressed in primary non-small cell lung cancer (NSCLC) tissues and cell lines, suggesting that CD47 is a promising therapeutic target for NSCLC. PMID: 27411490
  7. Among the various candidate genes involved in acute rejection, CD47 inhibits monocyte/macrophage-mediated phagocytosis by identifying the CD47 signal regulatory protein alpha (SIRP-alpha) as self/non-self. Tissue factor pathway inhibitor (TFPI) is involved in the regulation of the coagulation pathway and is able to bind to another ligand of CD47, thrombospondin-1 (TSP-1). PMID: 28393401
  8. Blocking CD47 using antibodies could efficiently induce macrophage-mediated phagocytosis of tumor cells and treat cancers. PMID: 27863402
  9. High CD47 expression is not associated with Fibrolamellar Hepatocellular Carcinoma. PMID: 28801364
  10. TTI-621 (SIRPalphaFc) is a fully human recombinant fusion protein that blocks the CD47-SIRPalpha axis by binding to human CD47 and enhancing phagocytosis of malignant cells..These data indicate that TTI-621 is active across a broad range of human tumors. PMID: 27856600
  11. this review highlights the various functions of CD47, discusses anti-tumor responses generated by both the innate and adaptive immune systems as a consequence of administering anti-CD47 blocking antibody, and finally elaborates on the clinical potential of CD47 blockade. PMID: 28077173
  12. we observed neutrophilic infiltration was slightly increased in anti-CD47 treated tumors compared to IgG control. PMID: 28100392
  13. In pulmonary hypertension TSP1-CD47 is upregulated, and contributes to pulmonary arterial vasculopathy and dysfunction. PMID: 27742621
  14. thrombospondin-1 via CD47 inhibits renal tubular epithelial cell recovery after ischemia reperfusion injury through inhibition of proliferation/self-renewal. PMID: 27259369
  15. Engineering macrophages to eat cancer: from "marker of self" CD47 and phagocytosis to differentiation PMID: 28522599
  16. the results obtained by combining bioinformatics and preclinical studies strongly suggest that targeting TSP-1/CD47 axis may represent a valuable therapeutic alternative for hampering melanoma spreading. PMID: 27349907
  17. Results indicated that surgical resection combined with anti-CD47 blocking immunotherapy promoted an inflammatory response and prolonged survival in xenograft animal model, and is therefore an attractive strategy for clinical translation. PMID: 28076333
  18. Results show that the stronger expression of CD47 by cancer cells and larger number of total macrophages/M2 were independently related to shorter survivals. PMID: 27322955
  19. Prolongation of transient porcine chimerism via transgenic expression of human CD47 in a primate model is associated with an immune modulating effect, leading to markedly prolonged survival of donor swine skin xenografts. PMID: 27232934
  20. CD47 is a promising cancer biomarker, and targeting CD47 presents an effective and potential therapeutic strategy through synthesized mechanisms PMID: 26446381
  21. CD47 seems to mediate fusion mostly through broad contact surfaces between the partners' cell membrane while syncytin-1 mediate fusion through phagocytic-cup like structure. PMID: 27714815
  22. The results suggested a critical role of CD47 in laryngeal squamous cell carcinoma development. PMID: 27855370
  23. Data show that anti-human CD47 antibody B6H12 decreased expression of epidermal growth factor receptor (EGFR) and the stem cell transcription factors. PMID: 26840086
  24. suggest that microglial activation may be partially caused by CD47/signal regulatory protein-alpha- and CD200/CD200R-mediated reductions in the immune inhibitory pathways PMID: 27095555
  25. Our results highlight an underappreciated contribution of the adaptive immune system to anti-CD47 adjuvant therapy and suggest that targeting both innate and adaptive immune checkpoints can potentiate the vaccinal effect of antitumor antibody therapy. PMID: 27091975
  26. Data suggest a reduction in the CD47 antigen/signal-regulatory protein alpha (SIRPalpha) pathway by programmed cell death protein 1 (PD-1) blockade, which regulates Myeloid-derived suppressor cells (MDSCs) and tumor associated macrophages (TAMs). PMID: 26573233
  27. atherogenesis is associated with upregulation of CD47, a key anti-phagocytic molecule that is known to render malignant cells resistant to programmed cell removal, or 'efferocytosis' PMID: 27437576
  28. CD47 is a critical regulator in the metastasis of osteosarcoma and results suggest that targeted inhibition of this antigen by anti-CD47 may be a novel immunotherapeutic approach in the management of this tumor. PMID: 26093091
  29. agents that block the CD47:SIRP-alpha engagement are attractive therapeutic targets as a monotherapy or in combination with additional immune-modulating agents for activating antitumor T cells in vivo PMID: 26116271
  30. CD47 is an adverse prognostic factor and promising therapeutic target in gastric cancer. PMID: 26077800
  31. study demonstrates that antigen-presenting cells(CD47+) in coculture with human macrophages show a CD47 concentration-dependent inhibition of phagocytosis PMID: 25593301
  32. CD47 expression contributes to the lethal breast cancer phenotype that is mediated by HIF-1. PMID: 26512116
  33. CD47 is highly expressed on cancer stem cells, but not on other nonmalignant cells in the pancreas. PMID: 25717063
  34. CD47 mediates signaling from the extracellular matrix that coordinately regulates basal metabolism and cytoprotective responses to radiation injury PMID: 26311851
  35. CD47 has a central role in hydrogen sulfate biosynthesis, regulation and signaling in T cells. PMID: 25747479
  36. Loss of cell surface CD47 clustering formation and binding avidity to SIRPalpha facilitate apoptotic cell clearance by macrophages. PMID: 26085683
  37. While CD47 expression on circulating AML blasts has been shown to be a negative prognostic marker for a very defined population of AML patients with NK AML, CD47 expression on AML BM blasts is not PMID: 25943033
  38. Velcro" engineering of high affinity CD47 ectodomain as signal regulatory protein alpha (SIRPalpha) antagonists that enhance antibody-dependent cellular phagocytosis PMID: 25837251
  39. during translation of CD47, the scaffold function of the 3' UTR facilitates binding of proteins to nascent proteins, to direct their transport or function--and this role of 3' UTRs can be regulated by polyadenylation PMID: 25896326
  40. Report poor prognosis/survival in luminal breast cancer patients with circulating tumor cells co-expressing MET and CD47. PMID: 25230070
  41. Staphylococcal SElX and SSL6 proteins bind cell surface receptors PSGL-1 and CD47, respectively. PMID: 24840181
  42. The thrombospondin-1 receptor CD47 directly or indirectly regulates intercellular communication mediated by the transfer of extracellular vesicles between vascular cells. PMID: 24887393
  43. expression is induced following EBV infection of B cells; ligation cases G1 arres PMID: 24911792
  44. CD47 regulates the epigenetic code by targeting UHRF1. PMID: 25550546
  45. Elevated postinjury thrombospondin 1-CD47 triggering aids differentiation of patients' defective inflammatory CD1a+dendritic cells. PMID: 25001859
  46. the TSP-derived 4N1K peptide effects on cell adhesion and integrin activation are independent of CD47 PMID: 24848268
  47. CD47 associates with and regulates VEGFR2 in T cells. CD47 signaling modulates the ability of VEGF to regulate proliferation and TCR signaling, and autocrine production of vascular endothelial growth factor by T cells contributes to this regulation. PMID: 25200950
  48. Suppression of CD47 by morpholino approach suppressed growth of hepatocellular carcinoma in vivo and exerted a chemosensitization effect through blockade of CTSS/PAR2 signaling. PMID: 24523067
  49. CD47 plays the pivotal role in the immune evasion of primary effusion lymphoma cells in body cavities. Therapeutic antibody targeting of CD47 could be an effective therapy for PEL. PMID: 24726056
  50. Data indicate that CD47 in cis interactions regulate LFA-1 (integrin alphaLbeta2) and VLA-4 (integrin alpha4beta1) integrin affinity, and this process plays a substantial role in the adhesion of T-cells. PMID: 24006483
  51. 'clustering' SIRPalpha into plasma membrane microdomains is essential for activated monocytes and macrophages to effectively interact with CD47 and initiate intracellular signaling PMID: 24143245
  52. Polymorphisms in the human inhibitory signal-regulatory protein alpha do not affect binding to its ligand CD47. PMID: 24550402
  53. Studies suggest that the mouse strain effect on xenogeneic engraftment might be ascribed mainly to the binding affinity of strain-specific polymorphic SIRPA with human CD47. PMID: 24269920
  54. Findings indicate CD47 as a potential prognostic marker for melanoma development as well as a target for therapeutic intervention with RNAi-based nanomedicines. PMID: 23774794
  55. An avidity-improved CD47 fusion protein (CD47-Var1) suppresses the release of a wide array of inflammatory cytokines by CD172a(+) cells. PMID: 23669395
  56. Anti-CD47 antibody-mediated phagocytosis of cancer cells by macrophages results in increased priming of transgenic CD8+ OT-I T cells but decreased priming of CD4+ OT-II T cells. PMID: 23690610
  57. Data indicate that the level of CD47 on erythroblast of myelodysplastic syndrome (MDS) patients had a significant positive correlation with their peripheral RBC count. PMID: 23642736
  58. The eSNP (single nucleotide polymorphism associated with expression) rs12695175 in CD47 associated with CRC specific survival (HR = 2.18, 95 % CI 1.10-4.33, CC versus AA) and with overall survival. PMID: 23011546
  59. CD47 deficiency confers cell survival through the activation of autophagic flux and identifies CD47 blockade as a pharmacological route to modulate autophagy for protecting tissue from radiation injury. PMID: 22874555
  60. Inhibitor of apoptosis proteins (IAPs) and their antagonists regulate spontaneous and tumor necrosis factor (TNF)-induced proinflammatory cytokine and chemokine production PMID: 23275336
  61. CD47(low) status on CD4 effectors is necessary for the contraction/resolution of the immune response in humans and mice. PMID: 22870271
  62. CD47 expression is a novel prognostic marker in esophageal squamous cell carcinoma that is directly inhibited by the miR-133a tumor suppressor. PMID: 22641236
  63. ectopic expression of murine Cd47 in human hepatocytes selectively favors engraftment upon transplantation into mice, a finding that should have a profound impact on the generation of robust humanized small animal models. PMID: 22535707
  64. Engulfment of hematopoietic stem cells caused by down-regulation of CD47 is critical in the pathogenesis of hemophagocytic lymphohistiocytosis. PMID: 22990013
  65. Both human endothelial and leukocyte CD47 are required for T cell transendothelial migration at sites of inflammation. PMID: 22815286
  66. Data show that CD47 is expressed in normal myelin and in foamy macrophages and reactive astrocytes within active multiple sclerosis (MS)lesions. PMID: 22734047
  67. Surfactant protein D (Sp-D) binds to membrane-proximal domain (D3) of signal regulatory protein alpha (SIRPalpha), a site distant from binding domain of CD47, while also binding to analogous region on signal regulatory protein beta (SIRPbeta). PMID: 22511785
  68. CD47 on experimentally aged erythrocytes is recognized by SIRPalpha. PMID: 22427202
  69. data,show that CD47 is a commonly expressed molecule on all cancers, its function to block phagocytosis is known, and blockade of its function leads to tumor cell phagocytosis and elimination PMID: 22451913
  70. a specific and age-dependent interaction of soluble fibrinogen with human RBC membrane; additionally we present CD47 as a putative mediator in this process. This interaction may contribute to RBC hyperaggregation in inflammation. PMID: 22079249
  71. vitamin D binding protein does not bind to TSP-1, CD36 or CD47 PMID: 22014686
  72. Reduced levels of CD47 are expected to result in a reduced level of phosphatidylserine exposure following ligation. PMID: 19794081
  73. inhibition of T cell receptor signaling by thrombospondin-1 is mediated by CD47 and requires its modification at Ser(64). PMID: 21343308
  74. Results demonstrate that the CD47 pathway in ITP patients abnormally modulates platelet homeostasis. PMID: 21211546
  75. Poor prognosis of breast cancer patients with high expression of CD47 is due to an active CD47/SIRPA signaling pathway in circulating cells. PMID: 20705613
  76. Thrombospondin-1 inhibits VEGF receptor-2 signaling by disrupting its association with CD47 PMID: 20923780
  77. The role of cis dimerization of signal regulatory protein alpha (SIRPalpha) in binding to CD47. PMID: 20826801
  78. Escherichia coli upregulation of CD47 in dendritic cells (DC) triggers production of DC natural ligand thrombospondin-1 and prevents the cell maturation process. PMID: 20675593
  79. Data show that cartilage oligomeric matrix protein (COMP) promotes cell attachment via independent mechanisms involving cell surface CD47 and alphaVbeta3 integrin and that cell attachment to COMP induces formation of fascin-stabilized actin microspikes. PMID: 20033473
  80. Inhibition of engulfment correlates with affinity of CD47 for SIRPA - but only at low levels of CD47. PMID: 20299253
  81. CD47 signaling is active within cells of the neurovascular interface. PMID: 20364320
  82. Our findings suggest that microRNA dysregulated in multiple sclerosis lesions reduce CD47 in brain resident cells, releasing macrophages from inhibitory control, thereby promoting phagocytosis of myelin. PMID: 19952055
  83. CD47/SIRP-alpha interactions are implicated in the pathogenesis of DC-driven allergic airway inflammation. PMID: 19748659
  84. The interaction of CD47 with SHPS-1 may contribute to the recruitment of B lymphocytes via endothelial cells under steady state conditions. PMID: 11907074
  85. Interactions of thrombospondins with alpha4beta1 integrin and CD47 differentially modulate T cell behavior PMID: 11980922
  86. regulates integrin function. Differential effects on alpha vbeta 3 and alpha 4beta1 integrin-mediated adhesion. PMID: 12218055
  87. mechanism of antigen-induced caspase-independent cell death in normal and leukemic cells PMID: 12351399
  88. An autocrine loop of the integrin alpha(V)beta(3)/CD47 receptor complex and thrombospondin-1 is identified as the molecular coupling device between mechanical loading and apoptosis. PMID: 12370491
  89. distribution of CD47, most restrained by cytoskeleton linkages plus a smaller fraction able to diffuse in the membrane, and colocalization with Rh protein complexes PMID: 12393442
  90. Evidence protein 4.2 interacts with the Rh membrane complex member CD47 obtained from red cells of patients with hereditary spherocytosis associated with complete protein 4.2 deficiency PMID: 12393467
  91. CD47 expressed on platelets significantly contributes to platelet adhesion on tumor necrosis factor-alpha (TNF-alpha)-stimulated vascular endothelial cells PMID: 12609828
  92. Ligation of CD47 by any of its known ligands rapidly induces heterotrimeric Gi alpha-dependent but caspase-independent apoptosis in Jurkat T cells and, importantly, in activated primary T cells. PMID: 12646616
  93. the extracellular Ig domain of IAP(CD47), when bound to thrombospondin, interacts with integrin alphaIIbbeta3 and can change alphaIIbbeta3 in a high affinity state without the requirement of intracellular signaling PMID: 12736272
  94. Interaction of CD47 with thrombospondin-1 contributes to the perpetuation of inflammation in rheumatoid synovitis. PMID: 12902472
  95. protein 4.2 strongly influences CD47 levels as well as the extent of membrane skeleton attachment in erythrocytes PMID: 14551146
  96. IAP gene expression is regulated by alpha-Pal PMID: 14747477
  97. CD47 recruits alpha(v)beta(3) and its associated signaling molecules to these domains PMID: 14966135
  98. CD47 has a role in inducing alpha4beta1 integrin activation and adhesion in sickle reticulocytes PMID: 15292185
  99. Review. The interaction between CD47 and SIRPalpha seems to be important to limit destruction of host cells in autoimmune diseases like autoimmune hemolytic anemia (AIHA), where macrophages destroy antibody or complement opsonized cells. PMID: 15359629
  100. CD47 short interferint RNA inhibited cell proliferation in cultures of hepatoma cells. PMID: 15498560

Show More

Hide All

Subcellular Location Cell membrane, Multi-pass membrane protein
Tissue Specificity Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain.
Database Links

HGNC: 1682

OMIM: 601028

KEGG: hsa:961

STRING: 9606.ENSP00000355361

UniGene: Hs.446414

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

© 2007-2020 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1