Recombinant Human Leukocyte surface antigen CD47(CD47),partial


In Stock
Code CSB-AP005211HU
See More Details
Product Type Immune Checkpoint
Size $195Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q08722
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Leukocyte Surface Antigen CD47; Antigenic Surface Determinant Protein OA3; Integrin-Associated Protein; IAP; Protein MER6; CD47; MER6
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human SIRPA in functional ELISA is less than 200 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence QLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKFKGRDIYTFDGALNKSTVPTDFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELTREGETIIELKYRVVSWFSP
Research Area Immunology
Source Mammalian cell
Gene Names CD47
Expression Region 19-139aa
Tag Info C-terminal FC-tagged
Mol. Weight 40.8 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Has a role in both cell adhesion by acting as an adhesion receptor for THBS1 on platelets, and in the modulation of integrins. Plays an important role in memory formation and synaptic plasticity in the hippocampus (By similarity). Receptor for SIRPA, binding to which prevents maturation of immature dendritic cells and inhibits cytokine production by mature dendritic cells. Interaction with SIRPG mediates cell-cell adhesion, enhances superantigen-dependent T-cell-mediated proliferation and costimulates T-cell activation. May play a role in membrane transport and/or integrin dependent signal transduction. May prevent premature elimination of red blood cells. May be involved in membrane permeability changes induced following virus infection.
Subcellular Location Cell membrane, Multi-pass membrane protein
Tissue Specificity Very broadly distributed on normal adult tissues, as well as ovarian tumors, being especially abundant in some epithelia and the brain.
Database Links

HGNC: 1682

OMIM: 601028

KEGG: hsa:961

STRING: 9606.ENSP00000355361

UniGene: Hs.446414

Related Products

CD47 Antibodies

CD47 Antibodies for Homo sapiens (Human)

CD47 Antibodies for Human

CD47 ELISA Kit

CD47 ELISA Kit for Homo sapiens (Human)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.