Recombinant Human Tumor necrosis factor receptor superfamily member 4 (TNFRSF4), partial (Active)

In Stock
Code CSB-AP005241HU
Abbreviation Recombinant Human TNFRSF4 protein, partial (Active)
MSDS
Size $184
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Mouse OX40L-His at 10μg/ml can bind Human OX40-6His (Biotinylated by NHS-biotin prior to testing), the ED50 of Recombinant Human OX40-6His is 1.44 ug/ml.
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
TNFRSF4; TXGP1L; Tumor necrosis factor receptor superfamily member 4; ACT35 antigen; OX40L receptor; TAX transcriptionally-activated glycoprotein 1 receptor; CD antigen CD134
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-216aa
Complete Sequence
LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Mol. Weight
21 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

OX40 (TNFRSF4/CD134) is a costimulatory immune checkpoint receptor critical to T-cell survival and memory formation, making it a high-priority target in immuno-oncology drug development. This recombinant human OX40 construct covers the extracellular ligand-binding domain (residues 29–216) and is expressed in mammalian cells to preserve native disulfide bonding and glycosylation essential for proper receptor folding. Functional ELISA confirms ligand-binding competence, with an ED50 of 1.44 µg/mL against immobilized OX40L, supporting use in receptor-ligand interaction assays, competitive blocking antibody screening, therapeutic antibody epitope mapping, and affinity characterization by SPR or BLI. The C-terminal 6×His tag facilitates oriented immobilization, while purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/µg satisfy the quality thresholds commonly required for sensitive binding assays and immune checkpoint research in cancer biology.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.; (Microbial infection) Acts as a receptor for human herpesvirus 6B/HHV-6B.
Gene References into Functions
  1. High OX40 expression in Ovarian carcinoma is correlated with chemosensitivity and improved recurrence free survival in Ovarian carcinoma . Patients might therefore benefit from a second line therapy. PMID: 29661166
  2. Increased OX40 expression is associated with gastric cancer. PMID: 29529339
  3. this study demonstrates that cSCCs contain an abundance of Tregs which can suppress tumoral effector T cell function and that activation of the costimulatory receptor OX40 enhances tumoral T cell responses. PMID: 27034329
  4. OX40 expression on T cells was positively associated with obesity in humans. PMID: 28612217
  5. Metabolically active CD4+ T cells expressing Glut1 and OX40 preferentially harbor HIV during in vitro infection. PMID: 28892135
  6. this study investigated whether CD134 is preferentially expressed on CD4 T cells in drug-induced hypersensitivity syndrome . PMID: 27174092
  7. blocking of both OX-40L and 4-1BBL reversed radiation-enhanced T-cell killing of human tumor targets as well as T-cell survival and activation. PMID: 26872462
  8. Low OX40 expression is associated with colorectal cancer. PMID: 26439988
  9. OX40 and its ligand are co stimulators for T lymphocytes. PMID: 26755473
  10. These studies provide the first direct evidence that ligation of tumour necrosis factor superfamily members and their cognate receptors is important for the control of viral lytic replication. PMID: 26467721
  11. Malaria patients and Plasmodium-infected rodents exhibit enhanced expression of the co-stimulatory receptor OX40 on CD4 T cells, which is abrogated following coordinate PD-1 co-inhibitory pathways, which are also upregulated during malaria. PMID: 25891357
  12. Identified two key amino acid residues within CD134 that are required for its interaction with herpesvirus 6B (HHV-6B) and for HHV-6B entry into cells. One of the residues (K79) allows access of the HHV-6B ligand to CD134. PMID: 26202244
  13. TL1A increases expression of CD25, LFA-1, CD134 and CD154, and induces IL-22 and GM-CSF production from effector CD4 T-cells PMID: 25148371
  14. High expression of OX40 is associated with type 1 diabetes. PMID: 24797972
  15. A cysteine-rich domain of CD134 that is critical for binding to the HHV-6B glycoprotein gH/gL/gQ1/gQ2 complex and HHV-6B infection. PMID: 25008928
  16. cirrhotic and hepatocellular carcinoma fragments moderately and highly infiltrated by Tregs, respectively, expressing OX40 PMID: 24756990
  17. data show that Ag-specific CD4(+) CD25(+) CD134(+) CD39(+) T cells are highly enriched for Treg cells, form a large component of recall responses and maintain a Treg-cell-like phenotype upon in vitro expansion. PMID: 24752698
  18. expression is associated with breast cancer in a stage dependent manner PMID: 23502335
  19. OX40 signals regulate CD8 T cell survival at least in part through maintaining expression of the anti-apoptotic molecule A1 PMID: 23936461
  20. Hyperactivation of the Akt pathway in Teff cells from children with lupus nephritis is associated with reduced induction of TRAF6 and up-regulation of OX40, which may cause Teff cell resistance to Treg cell-mediated suppression. PMID: 23896866
  21. This study identified OX40 as a key molecule and biomarker for rapid progression of HTLV-1-associated myelopathy/tropical spastic paraparesis. PMID: 23651542
  22. CD134 is a cellular receptor specific for human herpesvirus-6B entry. PMID: 23674671
  23. Head and neck cancer patients have decreased levels of alternative co-stimulatory receptors OX40 and 4-1BB. PMID: 22204816
  24. CD137 activity is directly proportional to colorectal cancer stage. Surgical resection of the tumor results in increased CD134 and CD137 expression PMID: 22343199
  25. We show that the inflammatory and cytotoxic function of CD4(+)CD28(null) T cells can be inhibited by blocking OX40 and 4-1BB costimulatory receptors. PMID: 22282196
  26. PAPP-A level was significantly related to soluble and membrane-bound OX40L in patients with ACS. PMID: 21111564
  27. Compared with control group, the expression of OX40 and Bcl-2 was significantly higher in allergic rhinitis. PMID: 19253527
  28. Transgenic OX40 forms a signaling complex in T cells that contains phosphoinositide 3-kinase (PI3K) and protein kinase B (PKB). PMID: 21289304
  29. High OX40 expression may be associated with malignant transformation, progression, invasion and metastasis in breast cancer biology. PMID: 20634005
  30. Possible proinflammatory effects of OX40L on the pathogenesis of atherosclerois. PMID: 21086790
  31. This study has shown that activation of OX40 induces CCL20 expression in the presence of antigen stimulation. PMID: 20400327
  32. The rs2298212G/A polymorphism in OX40 gene may be associated with the severity of coronary atherosclerotic disease. PMID: 20376799
  33. Data suggest the role of Perforin + cytotoxic T lymphocytes and CD134+ cells in the pathogenesis of autoimmunity of SLE. PMID: 20306696
  34. Pimecrolimus inhibits up-regulation of OX40 and synthesis of inflammatory cytokines upon secondary T cell activation by allogeneic dendritic cells. PMID: 12296857
  35. CD134 positive cells are identified within inflammatory lesions of active multiple sclerosis (MS), acute MS and chronic active MS as well as in acute disseminated leukoencephalitis patients. PMID: 14644025
  36. Mutagenesis showed that Asp60 and Asp62 are required for interaction with FIV, and modeling studies localized these two residues to the outer edge of domain 1 PMID: 15592478
  37. The expression of CD134 was markedly higher, compared to CD137, both on the day of the surgery and ten days after colorectal cancer surgery. PMID: 15638367
  38. Deficiencies in OX40 and CD30 signals were additive, secondary Ab responses were ablated.OX40/CD30 double-knockout OTII transgenic T cells fail to survive compared with normal T cells when cocultured with CD4(+)CD3(-) cells in vitro. PMID: 15778343
  39. Decrease in OX40 expression posttransplant includes the defective reconstitution of Treg cells, and the active inhibition of gene transcription by cyclosporine. PMID: 15808546
  40. stimulation of OX40/4-1BB rendered cells sensitive to apoptosis induced by TNF-alpha and reduced activation of NF-kappaB. OX40/4-1BB stimulation repressed the mitogen response in activated CD25+CD4+ T cells and preactivated CD8+ T cells PMID: 15941918
  41. CD3+ T lymphocytes co-expressing CD134 and CD137 antigens on peripheral blood revealed an increased percentages of OX-40/CD137 positive cells in patients with Graves' disease (p<0.025) compared to the controls. PMID: 16232366
  42. The relevance of these findings is supported by the vital functions fulfilled by OX40 in mammals as reflected by the high level of evolutionary conservation. PMID: 16329997
  43. The coexpression of CD25 and the costimulatory molecule CD134 on memory T-cells provides a novel marker for type 1 diabetes-associated T-cell immunity. PMID: 16380476
  44. OX40 ligation on CD4(+) T cells represents a potentially novel immunotherapeutic strategy that should be investigated to treat and prevent persistent virus infections, such as HIV-1 infection. PMID: 16456009
  45. OX40 is induced transiently on CD8(+) T cells upon activation and its signals contribute to both clonal expansion and functional reinforcement PMID: 16750861
  46. In the present study we found that costimulation via OX40 and TNF-R in OX40-expressing HIV-1-infected T cell lines leads to a marked reduction of HIV-1 production associated with rapid cell death. PMID: 18327975
  47. The expression of OX40 on CD4+ T cells in sentinel lymph nodes draining primary melanomas decreased withe more advanced tumor features, suggesting an immunosuppressive effect. PMID: 18374895
  48. Activity of OX40 ligand is enhanced by oligomerization and cell surface immobilization. PMID: 18397322
  49. the frequency of the most frequent haplotype, C-C-A-A, was significantly lower and that of the second most frequent, C-T-G-A, was significantly higher in hypertensive subjects than in controls. This difference was observed only in female patients PMID: 18398332
  50. These data offer a novel approach for UCB Treg expansion using aAPCs, including those coexpressing OX40L or 4-1BBL. PMID: 18645038

Show More

Hide All

Involvement in disease
Immunodeficiency 16 (IMD16)
Subcellular Location
Membrane; Single-pass type I membrane protein.
Database Links

HGNC: 11918

OMIM: 600315

KEGG: hsa:7293

STRING: 9606.ENSP00000368538

UniGene: Hs.129780

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*