Recombinant Human Tumor necrosis factor receptor superfamily member 4(TNFRSF4),partial

In Stock
Code CSB-AP005241HU
Product Type Immune Checkpoint
Size US$124
Uniprot No. P43489
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Tumor necrosis factor receptor superfamily member 4;TNFRSF4;OX40;CD134;Txgp1
Species Homo sapiens (Human)
Biological_Activity The ED50 as determined by its ability to bind Human TNFSF4 in functional ELISA is less than 25 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence LHCVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRCRAGTQPLDSYKPGVDCAPCPPGHFSPGDNQACKPWTNCTLAGKHTLQPASNSSDAICEDRDPPATQPQETQGPPARPITVQPTEAWPRTSQGPSTRPVEVPGGRAVA
Research Area Cancer
Source Mammalian cell
Gene Names TNFRSF4
Expression Region 29-216aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 21 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.
Involvement in disease Immunodeficiency 16 (IMD16)
Subcellular Location Membrane, Single-pass type I membrane protein
Database Links

HGNC: 11918

OMIM: 600315

KEGG: hsa:7293

STRING: 9606.ENSP00000368538

UniGene: Hs.129780

Related Products

TNFRSF4 Antibodies

TNFRSF4 Antibodies for Homo sapiens (Human)

TNFRSF4 Antibodies for Mus musculus (Mouse)

TNFRSF4 Proteins

TNFRSF4 Proteins for Mus musculus (Mouse)

TNFRSF4 Proteins for Homo sapiens (Human)

TNFRSF4 Proteins for Rattus norvegicus (Rat)

TNFRSF4 ELISA Kit

TNFRSF4 ELISA Kit for Homo sapiens (Human)

TNFRSF4 ELISA Kit for Mus musculus (Mouse)

TNFRSF4 ELISA Kit for Rattus norvegicus (Rat)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now!

We don't deal in spam.