Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP005301MO |
| Product Type | Immune Checkpoint |
| Size |
$65Purchase it in Cusabio online store (Shop online in the US. Customers outside the US, please order from local distributors.) |
| Uniprot No. | P09793 |
| Image |
|
| Storage Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alias | Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD152; Ctla4 |
| Species | Mus musculus (Mouse) |
| Biological_Activity | The ED50 as determined by its ability to bind Mouse B7-1 in functional ELISA is less than 20 ng/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD |
| Research Area | Immunology |
| Source | Mammalian cell |
| Gene Names | Ctla4 |
| Expression Region | 37-161aa |
| Tag Info | C-terminal 6xHis-tagged |
| Mol. Weight | 14.6 kDa |
| Protein Description | Partial |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28. |
| Subcellular Location | Cell membrane, Single-pass type I membrane protein |
| Tissue Specificity | Widely expressed with highest levels in lymphoid tissues. |
| Database Links |
KEGG: mmu:12477 STRING: 10090.ENSMUSP00000027164 UniGene: Mm.390 |
| Pathway | T cell receptor signaling pathway |
Ctla4 Antibodies for Mus musculus (Mouse)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA006163ZA01MO | Ctla4 Antibody | Mus musculus | ELISA, WB (ensure identification of antigen) |
Ctla4 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-CF006163MO | Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4) | in vitro E.coli expression system |
| CSB-YP006163MO1 CSB-BP006163MO1 CSB-MP006163MO1 |
Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),partial | Yeast Baculovirus Mammalian cell |
| CSB-EP006163MO1 | Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),Partial | E.coli |
Ctla4 ELISA Kit for Mus musculus (Mouse)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-E13637m | Mouse cytotoxic T lymphocyte associated antigen 4,CTLA-4 ELISA Kit | serum, plasma, tissue homogenates | 0.078 ng/mL |
Recombinant Torpedo californica Acetylcholine receptor subunit alpha(CHRNA1),partial
Express system: E.coli
Species: Tetronarce californica (Pacific electric ray) (Torpedo californica)
Recombinant Mouse Interleukin-7 receptor subunit alpha(Il7r),partial
Express system: Yeast
Species: Mus musculus (Mouse)
Recombinant Human Aryl hydrocarbon receptor nuclear translocator(ARNT),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Tyrosine-protein kinase JAK1(JAK1),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Macaca mulatta (Rhesus macaque) Interleukin-1 alpha(IL1A)
Express system: E.coli
Species: Macaca mulatta (Rhesus macaque)
