Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),partial (Active)

^{In Stock}

Code	CSB-AP005301MO
Size	US$1560Purchase it in Cusabio online store (only available for customers from the US)
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Product Details
Related Products
Target Data

Product Details

Purity	Greater than 95% as determined by SDS-PAGE.
Endotoxin	Less than 1.0 EU/μg as determined by LAL method.
Activity	The ED50 as determined by its ability to bind Mouse B7-1 in functional ELISA is less than 20 ng/ml.
Target Names	Ctla4
Uniprot No.	P09793
Research Area	Immunology
Alternative Names	Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD152; Ctla4
Species	Mus musculus (Mouse)
Source	Mammalian cell
Expression Region	37-161aa
Complete Sequence	AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Mol. Weight	14.6 kDa
Protein Length	Partial
Tag Info	C-terminal 6xHis-tagged
Form	Lyophilized powder
Buffer	Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Reconstitution	We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs	Protein FAQs
Storage Condition	Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life	The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time	Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes	Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA	Please contact us to get it.
Still Have Questions?	Leave a Message or Start an on-line Chat

Target Data

Function	Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Subcellular Location	Cell membrane, Single-pass type I membrane protein
Tissue Specificity	Widely expressed with highest levels in lymphoid tissues.
Database Links	KEGG: mmu:12477 STRING: 10090.ENSMUSP00000027164 UniGene: Mm.390