Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),partial (Active)

In Stock
Code CSB-AP005301MO
Product Type Immune Checkpoint
Size $65Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P09793
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD152; Ctla4
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by its ability to bind Mouse B7-1 in functional ELISA is less than 20 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Research Area Immunology
Source Mammalian cell
Gene Names Ctla4
Expression Region 37-161aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 14.6 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Tissue Specificity Widely expressed with highest levels in lymphoid tissues.
Database Links

KEGG: mmu:12477

STRING: 10090.ENSMUSP00000027164

UniGene: Mm.390

Pathway T cell receptor signaling pathway

Related Products

Ctla4 Antibodies

Ctla4 Antibodies for Mus musculus (Mouse)

Ctla4 Proteins

Ctla4 Proteins for Mus musculus (Mouse)

Ctla4 ELISA Kit

Ctla4 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.