Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),Partial

In Stock
Code CSB-EP006163MO1
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P09793
Relevance Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006163MO1 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctla4.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006163MO1 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctla4.
Storage Buffer Tris-based buffer,50% glycerol
Alias Cytotoxic T-lymphocyte-associated antigen 4
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Research Area Immunology
Source E.coli
Gene Names Ctla4
Protein Names Recommended name: Cytotoxic T-lymphocyte protein 4Alternative name(s): Cytotoxic T-lymphocyte-associated antigen 4 Short name= CTLA-4 CD_antigen= CD152
Expression Region 36-161aa
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Mol. Weight 33.9kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Subcellular Location Cell membrane, Single-pass type I membrane protein
Tissue Specificity Widely expressed with highest levels in lymphoid tissues.
Database Links

KEGG: mmu:12477

STRING: 10090.ENSMUSP00000027164

UniGene: Mm.390

Pathway T cell receptor signaling pathway

Related Products

Ctla4 Antibodies

Ctla4 Antibodies for Mus musculus (Mouse)

Ctla4 Proteins

Ctla4 Proteins for Mus musculus (Mouse)

Ctla4 ELISA Kit

Ctla4 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.