Recombinant Mouse Cytotoxic T-lymphocyte protein 4(Ctla4),Partial

In Stock
Code CSB-EP006163MO1
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006163MO1 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctla4.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006163MO1 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctla4.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity Greater than 90% as determined by SDS-PAGE.
Target Names Ctla4
Uniprot No. P09793
Research Area Immunology
Alternative Names Ctla4; Cd152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152
Species Mus musculus (Mouse)
Source E.coli
Expression Region 36-161aa
Target Protein Sequence EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 33.9kDa
Protein Length Extracellular Domain
Tag Info N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Target Data

Function Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Gene References into Functions
  1. Immunogenic mouse neuroblastoma acquires adaptive immune resistance by up-regulating PD-L1 expression, whereas PD-L1 is of lesser consequence in nonimmunogenic neuroblastoma tumors. Combining PD-L1 checkpoint inhibition with whole tumor cell/anti-CTLA-4 vaccination enhanced tumor cell killing, cured mice with established tumors, and induced long-term immune memory (6 months). PMID: 29377881
  2. the investigation of RANK and RANKL as possible novel immunotherapy targets in cancer is a rational approach. Here we have defined the mechanism of action of RANKL-RANK blockade in combination with anti-CTLA4, and provide insight into the combination efficacy observed in the case reports. PMID: 28634284
  3. reveal a novel CTLA-4-mediated pathway to attenuate cytotoxic T-lymphocytes and indicate the importance of post-transcriptional mechanisms in the regulation of anti-tumor immune responses PMID: 28644433
  4. The potential of the CTLA4 and G250 co-expression DNA vaccine. PMID: 28351777
  5. Tregs were observed to regulate CD4(+), but not CD8(+), T cell infiltration into tumors through a CTLA-4/CD80 dependent mechanism. Disrupting CTLA-4 interaction with CD80 was sufficient to induce CD4 T cell infiltration into tumors. PMID: 28856392
  6. These results suggest that CD44(+)CD117(+) T cells are stem cells and a specific T-cell phenotype that initially develops in the thymus, but they do not progress through DN3 and DN4 stages, lack a DP stage, and potently suppress T-cell proliferation and modulate the CTLA-4 pathway. PMID: 28279199
  7. data suggest that increased expression of checkpoint blockade molecules PD-1 and CTLA-4 on donor T cells is not sufficient to prevent GvHD, and that cooperation between checkpoint blockade signaling by host cells and donor Tregs is necessary to limit GvHD in allo-HSCT recipients PMID: 28953925
  8. Treg cells expand in both humans and mice in blood-stage malaria and interfere with conventional T helper cell responses and follicular T helper (TFH)-B cell interactions in germinal centers. Mechanistically, Treg cells function in a critical temporal window to impede protective immunity through cytotoxic-T-lymphocyte-associated protein-4 (CTLA-4). PMID: 28892065
  9. CTLA-4 expressed by FOXP3(+) regulatory T cells prevents inflammatory tissue attack and not T-cell priming in arthritis. PMID: 28497863
  10. results are consistent with a complex pathway in which CD28 is the primary driver of Treg proliferation and CTLA-4 functions as the main brake but is also dependent on TCR signals and interactions with CD80/CD86 PMID: 28053234
  11. CTLA-4(+) microvesicles can competitively bind B7 costimulatory molecules on bystander dendritic cells, resulting in downregulation of B7 surface expression. PMID: 26979751
  12. this study shows that miR-155 is modulated by a major dust mite allergen, Dermatophagoides farinae (Df1), and increases CD4+ T cell proliferation through the downregulation of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) expression PMID: 28110885
  13. CTLA-4 regulates atherosclerosis by suppressing proatherogenic immune responses. PMID: 27055906
  14. Data suggest enhanced clinical benefit from combining CTLA-4 antigen blockade with poxvirus-based active immunotherapy. PMID: 26961085
  15. up-regulated expression correlates with the tolerogenic effect of syngeneic hematopoietic stem cell transplantation PMID: 26311302
  16. Induced Treg Cells Augment the Th17-Mediated Intestinal Inflammatory Response in a CTLA4-Dependent Manner PMID: 26950218
  17. CTLA-4 has a regulatory T cell-intrinsic role in limiting peripheral regulatory T cell expansion and activation, and in their capacity to control conventional T cells. PMID: 26371185
  18. The Ctla4 SNP (e2_77A/G) does not alter diabetes susceptibility, but does control mRNA alternative splicing. PMID: 26450994
  19. Sorafenib suppressed the expression of immunosuppressive factors in MDSCs. These data indicate that combination therapy of sorafenib and anti-CTLA-4 Ab may be effective in advanced kidney cancer patients. PMID: 25845968
  20. The co-stimulatory molecule CTLA-4 mediates in vitro differentiation of iTreg cells. PMID: 25238105
  21. The bullseye immunological synapse formation is mediated by CTLA4, and may negatively control T-cell activation as a suppressive synapse. PMID: 25287444
  22. this study reports that regulatory T (Treg) cells orchestrate memory T cell quiescence by suppressing effector and proliferation programs through inhibitory receptor, cytotoxic- T-lymphocyte-associated protein-4 (CTLA-4). PMID: 26084026
  23. Short-term blockade with anti-CTLA-4 antibody in wild-type mice is sufficient to elicit follicular helper T cell generation and germinal center development. The latter occurs in a CD28-dependent manner. PMID: 25548162
  24. CTLA-4 and mTOR down-regulation cooperate during CD8+ T cell priming to promote memory formation and metabolic readiness. PMID: 25624453
  25. role in Treg cell-mediated control of T follicular regulatory cell proliferation, germinal center formation,and of humoral immune responses PMID: 25526312
  26. The study concludes that although the presence of CTLA4 plays a critical role in controlling homeostasis of T cells, its quantitative variation may impose diverse or even opposing effects on distinct lineages of T cells, an optimal sum of which is necessary for preservation of T cell immunity while suppressing tissue damage. PMID: 25246499
  27. cardiomyocytes can express CD80; this expression pattern can resist CTL-mediated lysis through CTLA-4 pathway PMID: 24507064
  28. Alternative splice forms of CTLA-4 induced by antisense mediated splice-switching influences autoimmune diabetes susceptibility in NOD mice. PMID: 24494586
  29. CTLA4(apt) fused to a STAT3-targeting siRNA (CTLA4(apt)-STAT3 siRNA) resulted in internalization into tumor-associated CD8 T cells and silencing of STAT3, which activated tumor antigen-specific T cells in tumor models. PMID: 24892807
  30. results show that CTLA-4 promotes Tc17 differentiation that results in robust Tc17 responses PMID: 24723371
  31. These data suggest that effects associated with and mediated through Tyr201 of CTLA-4s intracellular domain are critical for Treg-cell function. PMID: 24648182
  32. Our in vitro experiments revealed that IL-2 induced expression of CTLA-4 in mouse natural killer cells PMID: 24688023
  33. These novel insights into the differential regulation of CTLA-4 coinhibition on CD4(+) T cells have implications for the immunomodulation of pathologic T cell responses during transplantation and autoimmunity. PMID: 24493820
  34. SOCS3 interacts with CTLA-4 and negatively regulates CTLA-4 levels in T cells, providing a mechanistic explanation for the expansion of regulatory T cells in CD4-SOCS3 during experimental autoimmune uveitis. PMID: 24101549
  35. This novel mechanism of CTLA-4lg immunotherapy may lead to an ideal anti-obesity/inflammation/insulin resistance agent. PMID: 23872146
  36. Data show coexpression of PD-1 and CTLA-4 correlates with more severe dysfunction of tumor-specific CD8+ T cells. PMID: 23633484
  37. Our results identify CTLA-4 as a key factor that regulates the composition of the Foxp3+ T-cell population in the intestine. PMID: 22910217
  38. The soluble isoform of CTLA-4 is a regulator of T-cell responses. PMID: 23400950
  39. The presence of the alternatively spliced 1/4 CTLA-4 isoform can further promote autoimmunity and autoimmune pathology in lupus-prone mice and suggests that altered splicing of CTLA4 contributes to the expression of autoimmune disease. PMID: 23203389
  40. Li-CTLA-4 expressed at physiologic levels in the CTLA-4-sufficient NOD background suppresses autoimmunity; but, the functionality of the li-CTLA-4 isoform depends on the presence of the full-length molecule to alter effector T cell signaling. PMID: 23293354
  41. CTLA-4 is expressed in the corticomedullary region of the thymus. Its absence alters the response of CD4(+)CD8(-) thymocytes to self-antigen recognition, which affects the quantity of the Treg cells and broadens the repertoire of peripheral T cells. PMID: 23267099
  42. pathways by which cAMP regulates CTLA4 expression, focusing on transcriptional activation PMID: 23024062
  43. Findings indicate that CTLA-4-negative regulation of conventional T cells (Tconvs) but not regulatory T cells (Tregs) in immune responses. PMID: 23047820
  44. direct evidence that CTLA4 inhibits spontaneous tumor development PMID: 22777737
  45. CTLA-4 on normal effector CD4-positive T cells completely abrogates the dramatically increased expansion normally experienced by their CTLA-4-deficient counterparts. PMID: 22753941
  46. a potential new role for CTLA-4 in Treg differentiation PMID: 22337882
  47. the importance of intracellular localization for CTLA-4 protein function and reveal that CTLA-4 protein externalization imparts suppressor function to both regulatory and conventional CD4(+) T cells. PMID: 22403258
  48. boosting CD152 or its down-stream signal transduction could aid therapies aimed at sensitizing T lymphocytes for optimal migration, thus contributing to a precise and effective immune response. PMID: 22412835
  49. The expression of CTLA-4 and PD-1 on T cells correlates with the extent of proinflammatory responses induced during Plasmodium berghei infection, being higher in C57BL/6 than in BALB/c mice. PMID: 22319445
  50. CTLA4-Ig may promote neuronal differentiation during the treatment of neurological diseases with cell replacement therapy PMID: 22155494
  51. the function of the 1/4CTLA-4 isoform is distinct from that of CTLA-4 in that it enhances T cell activation and promotes autoimmunity rather than inhibiting immune responses. PMID: 22124121
  52. Studies indicate that CTLA-4 and PD-1 blockade augmented antitumor immunity. PMID: 21700764
  53. Data for and against the T cell-intrinsic and -extrinsic functions of CTLA4 are presented (Review) PMID: 22116087
  54. The role of CTLA4 as an inhibitory co-signaling molecule in activated T lymphocytes is reviewed. Review. PMID: 22027421
  55. T-cell co-inhibitory blockade combined with alphaCTLA-4 and active co-stimulation with alpha4-1BB promotes rejection of B16 melanoma in with a vaccine; KLRG1 is a useful marker for monitoring the anti-tumor immune response elicited by this therapy PMID: 21559358
  56. CTLA4 signal is required for T cell tolerance in the context of acute GVHD after myeloablative allogeneic bone marrow transplantation. PMID: 21447398
  57. loss of sCTLA-4 impairs the function of Treg cells and compromises immune regulation, with the notable consequence of increasing the risk of autoimmunity in the NOD background. PMID: 21602513
  58. This study shows that the quantity of memory CD4+ T cells generated during an immune response is regulated independently of CTLA-4 signaling but CD4+ T cells are strongly influenced by CTLA-4. PMID: 21478403
  59. the blockade of CTLA-4 did not unlock the stability of Treg cells PMID: 21418778
  60. Foxp3(+) Treg cell-mediated protection was dependent upon CTLA-4 but not IL-10. PMID: 21170302
  61. study shows CTLA-4 can capture its ligands (CD80, CD86)from opposing cells by trans-endocytosis; data reveal mechanism of immune regulation in which CTLA-4 acts as an effector molecule to inhibit CD28 costimulation by cell-extrinsic depletion of ligands PMID: 21474713
  62. The CTLA-4-mediated suppression was demonstrated by the in vitro anergy induction in regulatory T cells constitutively expressing CTLA-4. PMID: 20870175
  63. The interaction of CTLA-4 and B7 inhibits T helper cell type (Th)17 differentiation in vitro and in vivo and suppresses Th17-mediated autoimmunity. Blocking the CTLA4-B7 interaction potentiates Th17 cell differentiation in vitro and in vivo. PMID: 20601598
  64. Abnormal expression of CD28 and CTLA4 in T cells was observed in mice with aplastic anemia. PMID: 16463658
  65. In a murine model of acute lung injury (ALI), analysis of lipopolysaccharide-induced CD4-positive T helper cell pathways reveals increased CTLA4 expression contributing to experimental ALI. PMID: 20385880
  66. SP-D decreases allergen responses, an effect that may be mediated by increase of CTLA4 in T cells. PMID: 20435925
  67. dendritic cell directed enhanced CTLA-4 engagement upon pancreatic beta cell Ag presentation results in the suppression of autoreactive T cell response in NOD mice PMID: 20483724
  68. CTLA-4 mediates signals via the activation of the ubiquitin ligase Itch PMID: 20417562
  69. blockage does not abrogate the protective effect of regulatory T cells in a pregnancy model PMID: 19811462
  70. results suggest that combination blockade of the PD-1/PD-L1- and CTLA-4-negative costimulatory pathways allows tumor-specific T cells that would otherwise be inactivated to continue to expand and carry out effector functions PMID: 20160101
  71. show here that lack of CTLA-4 in regulatory T cells leads to aberrant activation and expansion of conventional T cells. PMID: 20080649
  72. CTLA-4 pathway exerts its major effects on T cell immune responses via regulation of the cell cycle. PMID: 11807776
  73. The B7-CD28/CTLA-4 costimulatory pathway has a dominant role in regulating T-cell activation. Antagonists enable graft survival and suppress autoimmunity. PMID: 11826754
  74. CTLA-4 contributes to the maintenance of peripheral T cell tolerance to self antigens. PMID: 11867713
  75. Negative effect of CTLA-4 on induction of T-cell immunity in vivo to B7-1+, but not B7-2+, murine myelogenous leukemia. PMID: 11877291
  76. CTLA-4 is required to maintain the unresponsive state of the tolerized T cells upon antigenic stimulation under inflammatory conditions and, therefore, have important implications for therapeutic regulation of autoimmune disease. PMID: 11920563
  77. B7-CTLA4 interaction promotes cognate destruction of tumor cells by cytotoxic T lymphocytes in vivo. PMID: 11929778
  78. A three-lysine motif in the juxtamembrane portion of the CTLA-4 cytoplasmic tail has been identified as the region of binding and down-regulation by the regulatory subunit of protein phosphatase 2A (PP2A). PMID: 11994459
  79. Expression of a mutant membrane-bound single-chain anti-CTLA-4 antibody on allogeneic tumor cells results in suppression of T cell activation in vivo and prevents rejection of the CTLA-4-competent allogeneic tumor. PMID: 12097362
  80. Local expresssion in a pancreatic beta-cell line suppresses accelerated graft rejection response induced by donor-specific transfusion PMID: 12107727
  81. Re-establishing peripheral tolerance in the absence of CTLA-4: complementation by wild-type T cells points to an indirect role for CTLA-4. PMID: 12165509
  82. CTLA-4 expression restricts pathogen-specific T cell responses and prevents immune pathology during infection with Plasmodium berghei. PMID: 12193697
  83. In T cells deficient in CD80 and CD86 (double knockout), or CTLA-4, CD80, and CD86 (triple knockout), CTLA-4 ligation up-regulates and sustains c-Jun N-terminal kinase activation, while inhibiting extracellular signal-regulated kinase activity. PMID: 12244135
  84. CTLA-4 negative signaling plays a critical role in regulating alloimmunity, especially under conditions where the alloreactive T cell clone size is relatively small. PMID: 12244168
  85. with B7 antigen, is essential for generating regulatory cells after intratracheal delivery of alloantigen in mice PMID: 12352894
  86. CTLA-4 expression on antigen-specific cells is required for oral tolerance. PMID: 12355454
  87. CTLA-4-Ig regulates cytokine-dependent tryptophan catabolism in B7-expressing dendritic cells, suggesting that tryptophan catabolism modulation is the way CTLA-4 functions in vivo & that CTLA-4 acts as a ligand for signal-transducing B7 receptors. PMID: 12368911
  88. Role of CTLA4 in enhancing cell-cycle progression and survival of CD4(+) T lymphocytes after activation. PMID: 12429713
  89. CTLA-4 may preferentially dampen pathologic immune responses to self proteins while permitting protective immunity to foreign agents. PMID: 12444125
  90. In a study of germinal center responses in mice with compromised ability to signal through T cell CTLA-4, a critical role is shown for CTLA-4 in down-regulating T cell help for germinal center B cells. PMID: 12496387
  91. Negative regulation of T cell receptor-lipid raft interaction by cytotoxic T lymphocyte-associated antigen 4. PMID: 12515820
  92. CTLA-4 has a critical role in T cell differentiation PMID: 12524538
  93. role of CD28(SDYMNM) and CTLA-4(GVYVKM) motifs in distinguishing positive versus negative coreceptor signaling in T cells PMID: 12525576
  94. Anti-CD28 has a potent adjuvant effect on the antibody response to soluble antigens mediated through CTLA-4 by-pass PMID: 12594842
  95. Inhibition of dipeptidylpeptidase IV (DPP IV, CD26) activity modulates surface expression of this protein in stress-induced abortion. PMID: 12675235
  96. In the mouse model of type 1 diabetes, susceptibility was also associated with variation in CTLA-4 gene splicing with reduced production of a splice form encoding a molecule lacking the CD80/CD86 ligand-binding domain PMID: 12724780
  97. Engagement of CTLA-4 inhibits deletion of superantigen-mediated deletion; in the absence of CTLA-4, TCR V beta 3+ thymocytes are more readily deleted. PMID: 12759417
  98. A signal through CTLA4, rather than through CD28, plays an important role in the induction of hyporesponsiveness by intratracheal delivery of alloantigen in this model. PMID: 12777848
  99. BTLA is a third inhibitory receptor on T lymphocytes with similarities to cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) and programmed death 1 (PD-1). PMID: 12796776
  100. Iris pigment epithelial cells constitutively express cell surface CD86, which enables the cells to contact inhibit T cells via direct interaction with CTLA-4. PMID: 12835481

Show More

Hide All

Subcellular Location Cell membrane, Single-pass type I membrane protein
Tissue Specificity Widely expressed with highest levels in lymphoid tissues.
Database Links

KEGG: mmu:12477

STRING: 10090.ENSMUSP00000027164

UniGene: Mm.390

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved. 鄂ICP备15011166号-1