Recombinant Mouse Cytotoxic T-lymphocyte protein 4 (Ctla4),Partial

In Stock
Code CSB-EP006163MO1
Abbreviation Recombinant Mouse Ctla4 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006163MO1 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctla4.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP006163MO1 could indicate that this peptide derived from E.coli-expressed Mus musculus (Mouse) Ctla4.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Ctla4; Cd152; Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD antigen CD152
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
36-161aa
Target Protein Sequence
EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
33.9kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The Mouse Ctla4 protein's gene (36-161aa) is inserted into a plasmid vector, forming recombinant plasmid, which is introduced into e.coli cells. e.coli cells surviving in the presence of a specific antibiotic are selected and then cultured under conditions promoting the expression of the gene of interest. The protein features a N-terminal 10xHis-SUMO tag and C-terminal Myc tag fusion. After expression, the recombinant Mouse Ctla4 protein is isolated and purified from the cell lysate through affinity purification. Denaturing SDS-PAGE is utilized to resolve the resulting recombinant protein, revealing a purity exceeding 90%.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Inhibitory receptor acting as a major negative regulator of T-cell responses. The affinity of CTLA4 for its natural B7 family ligands, CD80 and CD86, is considerably stronger than the affinity of their cognate stimulatory coreceptor CD28.
Gene References into Functions
  1. Immunogenic mouse neuroblastoma acquires adaptive immune resistance by up-regulating PD-L1 expression, whereas PD-L1 is of lesser consequence in nonimmunogenic neuroblastoma tumors. Combining PD-L1 checkpoint inhibition with whole tumor cell/anti-CTLA-4 vaccination enhanced tumor cell killing, cured mice with established tumors, and induced long-term immune memory (6 months). PMID: 29377881
  2. the investigation of RANK and RANKL as possible novel immunotherapy targets in cancer is a rational approach. Here we have defined the mechanism of action of RANKL-RANK blockade in combination with anti-CTLA4, and provide insight into the combination efficacy observed in the case reports. PMID: 28634284
  3. reveal a novel CTLA-4-mediated pathway to attenuate cytotoxic T-lymphocytes and indicate the importance of post-transcriptional mechanisms in the regulation of anti-tumor immune responses PMID: 28644433
  4. The potential of the CTLA4 and G250 co-expression DNA vaccine. PMID: 28351777
  5. Tregs were observed to regulate CD4(+), but not CD8(+), T cell infiltration into tumors through a CTLA-4/CD80 dependent mechanism. Disrupting CTLA-4 interaction with CD80 was sufficient to induce CD4 T cell infiltration into tumors. PMID: 28856392
  6. These results suggest that CD44(+)CD117(+) T cells are stem cells and a specific T-cell phenotype that initially develops in the thymus, but they do not progress through DN3 and DN4 stages, lack a DP stage, and potently suppress T-cell proliferation and modulate the CTLA-4 pathway. PMID: 28279199
  7. data suggest that increased expression of checkpoint blockade molecules PD-1 and CTLA-4 on donor T cells is not sufficient to prevent GvHD, and that cooperation between checkpoint blockade signaling by host cells and donor Tregs is necessary to limit GvHD in allo-HSCT recipients PMID: 28953925
  8. Treg cells expand in both humans and mice in blood-stage malaria and interfere with conventional T helper cell responses and follicular T helper (TFH)-B cell interactions in germinal centers. Mechanistically, Treg cells function in a critical temporal window to impede protective immunity through cytotoxic-T-lymphocyte-associated protein-4 (CTLA-4). PMID: 28892065
  9. CTLA-4 expressed by FOXP3(+) regulatory T cells prevents inflammatory tissue attack and not T-cell priming in arthritis. PMID: 28497863
  10. results are consistent with a complex pathway in which CD28 is the primary driver of Treg proliferation and CTLA-4 functions as the main brake but is also dependent on TCR signals and interactions with CD80/CD86 PMID: 28053234
  11. CTLA-4(+) microvesicles can competitively bind B7 costimulatory molecules on bystander dendritic cells, resulting in downregulation of B7 surface expression. PMID: 26979751
  12. this study shows that miR-155 is modulated by a major dust mite allergen, Dermatophagoides farinae (Df1), and increases CD4+ T cell proliferation through the downregulation of cytotoxic T lymphocyte-associated antigen 4 (CTLA-4) expression PMID: 28110885
  13. CTLA-4 regulates atherosclerosis by suppressing proatherogenic immune responses. PMID: 27055906
  14. Data suggest enhanced clinical benefit from combining CTLA-4 antigen blockade with poxvirus-based active immunotherapy. PMID: 26961085
  15. up-regulated expression correlates with the tolerogenic effect of syngeneic hematopoietic stem cell transplantation PMID: 26311302
  16. Induced Treg Cells Augment the Th17-Mediated Intestinal Inflammatory Response in a CTLA4-Dependent Manner PMID: 26950218
  17. CTLA-4 has a regulatory T cell-intrinsic role in limiting peripheral regulatory T cell expansion and activation, and in their capacity to control conventional T cells. PMID: 26371185
  18. The Ctla4 SNP (e2_77A/G) does not alter diabetes susceptibility, but does control mRNA alternative splicing. PMID: 26450994
  19. Sorafenib suppressed the expression of immunosuppressive factors in MDSCs. These data indicate that combination therapy of sorafenib and anti-CTLA-4 Ab may be effective in advanced kidney cancer patients. PMID: 25845968
  20. The co-stimulatory molecule CTLA-4 mediates in vitro differentiation of iTreg cells. PMID: 25238105
  21. The bullseye immunological synapse formation is mediated by CTLA4, and may negatively control T-cell activation as a suppressive synapse. PMID: 25287444
  22. this study reports that regulatory T (Treg) cells orchestrate memory T cell quiescence by suppressing effector and proliferation programs through inhibitory receptor, cytotoxic- T-lymphocyte-associated protein-4 (CTLA-4). PMID: 26084026
  23. Short-term blockade with anti-CTLA-4 antibody in wild-type mice is sufficient to elicit follicular helper T cell generation and germinal center development. The latter occurs in a CD28-dependent manner. PMID: 25548162
  24. CTLA-4 and mTOR down-regulation cooperate during CD8+ T cell priming to promote memory formation and metabolic readiness. PMID: 25624453
  25. role in Treg cell-mediated control of T follicular regulatory cell proliferation, germinal center formation,and of humoral immune responses PMID: 25526312
  26. The study concludes that although the presence of CTLA4 plays a critical role in controlling homeostasis of T cells, its quantitative variation may impose diverse or even opposing effects on distinct lineages of T cells, an optimal sum of which is necessary for preservation of T cell immunity while suppressing tissue damage. PMID: 25246499
  27. cardiomyocytes can express CD80; this expression pattern can resist CTL-mediated lysis through CTLA-4 pathway PMID: 24507064
  28. Alternative splice forms of CTLA-4 induced by antisense mediated splice-switching influences autoimmune diabetes susceptibility in NOD mice. PMID: 24494586
  29. CTLA4(apt) fused to a STAT3-targeting siRNA (CTLA4(apt)-STAT3 siRNA) resulted in internalization into tumor-associated CD8 T cells and silencing of STAT3, which activated tumor antigen-specific T cells in tumor models. PMID: 24892807
  30. results show that CTLA-4 promotes Tc17 differentiation that results in robust Tc17 responses PMID: 24723371
  31. These data suggest that effects associated with and mediated through Tyr201 of CTLA-4s intracellular domain are critical for Treg-cell function. PMID: 24648182
  32. Our in vitro experiments revealed that IL-2 induced expression of CTLA-4 in mouse natural killer cells PMID: 24688023
  33. These novel insights into the differential regulation of CTLA-4 coinhibition on CD4(+) T cells have implications for the immunomodulation of pathologic T cell responses during transplantation and autoimmunity. PMID: 24493820
  34. SOCS3 interacts with CTLA-4 and negatively regulates CTLA-4 levels in T cells, providing a mechanistic explanation for the expansion of regulatory T cells in CD4-SOCS3 during experimental autoimmune uveitis. PMID: 24101549
  35. This novel mechanism of CTLA-4lg immunotherapy may lead to an ideal anti-obesity/inflammation/insulin resistance agent. PMID: 23872146
  36. Data show coexpression of PD-1 and CTLA-4 correlates with more severe dysfunction of tumor-specific CD8+ T cells. PMID: 23633484
  37. Our results identify CTLA-4 as a key factor that regulates the composition of the Foxp3+ T-cell population in the intestine. PMID: 22910217
  38. The soluble isoform of CTLA-4 is a regulator of T-cell responses. PMID: 23400950
  39. The presence of the alternatively spliced 1/4 CTLA-4 isoform can further promote autoimmunity and autoimmune pathology in lupus-prone mice and suggests that altered splicing of CTLA4 contributes to the expression of autoimmune disease. PMID: 23203389
  40. Li-CTLA-4 expressed at physiologic levels in the CTLA-4-sufficient NOD background suppresses autoimmunity; but, the functionality of the li-CTLA-4 isoform depends on the presence of the full-length molecule to alter effector T cell signaling. PMID: 23293354
  41. CTLA-4 is expressed in the corticomedullary region of the thymus. Its absence alters the response of CD4(+)CD8(-) thymocytes to self-antigen recognition, which affects the quantity of the Treg cells and broadens the repertoire of peripheral T cells. PMID: 23267099
  42. pathways by which cAMP regulates CTLA4 expression, focusing on transcriptional activation PMID: 23024062
  43. Findings indicate that CTLA-4-negative regulation of conventional T cells (Tconvs) but not regulatory T cells (Tregs) in immune responses. PMID: 23047820
  44. direct evidence that CTLA4 inhibits spontaneous tumor development PMID: 22777737
  45. CTLA-4 on normal effector CD4-positive T cells completely abrogates the dramatically increased expansion normally experienced by their CTLA-4-deficient counterparts. PMID: 22753941
  46. a potential new role for CTLA-4 in Treg differentiation PMID: 22337882
  47. the importance of intracellular localization for CTLA-4 protein function and reveal that CTLA-4 protein externalization imparts suppressor function to both regulatory and conventional CD4(+) T cells. PMID: 22403258
  48. boosting CD152 or its down-stream signal transduction could aid therapies aimed at sensitizing T lymphocytes for optimal migration, thus contributing to a precise and effective immune response. PMID: 22412835
  49. The expression of CTLA-4 and PD-1 on T cells correlates with the extent of proinflammatory responses induced during Plasmodium berghei infection, being higher in C57BL/6 than in BALB/c mice. PMID: 22319445
  50. CTLA4-Ig may promote neuronal differentiation during the treatment of neurological diseases with cell replacement therapy PMID: 22155494

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Tissue Specificity
Widely expressed with highest levels in lymphoid tissues.
Database Links

KEGG: mmu:12477

STRING: 10090.ENSMUSP00000027164

UniGene: Mm.390

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*