Recombinant Mouse Tumor necrosis factor receptor superfamily member 4(Tnfrsf4),partial (Active)

In Stock
Code CSB-AP005321MO
Product Type Immune Checkpoint
Size $124Purchase it in Cusabio online store
(Shop online in the US. Customers outside the US,
please order from local distributors.)
Uniprot No. P47741
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Storage Buffer Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4
Alias Tumor necrosis factor receptor superfamily member 4;Tnfrsf4;OX40;CD134;Txgp1
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by its ability to bind Mouse TNFSF4 in functional ELISA is less than 2 ug/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Research Area Cancer
Source Mammalian cell
Gene Names Tnfrsf4
Expression Region 20-211aa
Tag Info C-terminal FC-tagged
Mol. Weight 48.1 kDa
Protein Description Extracellular Domain
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).
Subcellular Location Membrane, Single-pass type I membrane protein
Database Links

KEGG: mmu:22163

STRING: 10090.ENSMUSP00000030952

UniGene: Mm.13885

Related Products

Tnfrsf4 Antibodies

Tnfrsf4 Antibodies for Mus musculus (Mouse)

Tnfrsf4 Proteins

Tnfrsf4 Proteins for Mus musculus (Mouse)

Tnfrsf4 ELISA Kit

Tnfrsf4 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.