Your Good Partner in Biology Research
Tel : 301-363-4651
Your Good Partner in Biology Research
| Code | CSB-AP005331MO |
| See More Details |  |
| Product Type | Immune Checkpoint |
| Size |
$124Purchase it in Cusabio online store (only available for customers from the US) |
| Uniprot No. | P47741 |
| Image |
|
| Storage Buffer | Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4 |
| Alias | Tumor necrosis factor receptor superfamily member 4;Tnfrsf4;OX40;CD134;Txgp1 |
| Species | Mus musculus (Mouse) |
| Biological_Activity | The ED50 as determined by its ability to bind Mouse TNFSF4 in functional ELISA is less than 50 ug/ml. |
| Purity | Greater than 95% as determined by SDS-PAGE. |
| Endotoxin | Less than 1.0 EU/μg as determined by LAL method. |
| Sequence | VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP |
| Research Area | Cancer |
| Source | Mammalian cell |
| Gene Names | Tnfrsf4 |
| Expression Region | 20-211aa |
| Tag Info | C-terminal 6xHis-tagged |
| Mol. Weight | 22.1 kDa |
| Protein Description | Extracellular Domain |
| Still Have Questions? | Leave a Message or Start an on-line Chat |
| Function | Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity). |
| Subcellular Location | Membrane, Single-pass type I membrane protein |
| Database Links |
KEGG: mmu:22163 STRING: 10090.ENSMUSP00000030952 UniGene: Mm.13885 |
Tnfrsf4 Antibodies for Mus musculus (Mouse)
| Code | Product Name | Species Reactivity | Application |
|---|---|---|---|
| CSB-PA023981HD01MO | Tnfrsf4 Antibody, Biotin conjugated | Mouse | ELISA |
| CSB-PA023981HC01MO | Tnfrsf4 Antibody, FITC conjugated | Mouse | ELISA |
| CSB-PA023981HB01MO | Tnfrsf4 Antibody, HRP conjugated | Mouse | ELISA |
| CSB-PA023981HA01MO | Tnfrsf4 Antibody | Mouse | ELISA |
Tnfrsf4 Proteins for Mus musculus (Mouse)
| Code | Product Name | Source |
|---|---|---|
| CSB-CF023981MO | Recombinant Mouse Tumor necrosis factor receptor superfamily member 4(Tnfrsf4) | in vitro E.coli expression system |
| CSB-YP023981MO CSB-BP023981MO CSB-MP023981MO |
Recombinant Mouse Tumor necrosis factor receptor superfamily member 4(Tnfrsf4),partial | Yeast Baculovirus Mammalian cell |
| CSB-EP023981MO | Recombinant Mouse Tumor necrosis factor receptor superfamily member 4(Tnfrsf4),partial | E.coli |
Tnfrsf4 ELISA Kit for Mus musculus (Mouse)
| Code | Product Name | Sample Types | Sensitivity |
|---|---|---|---|
| CSB-EL023981MO | Mouse Tumor necrosis factor receptor superfamily member 4(TNFRSF4) ELISA kit | Request Information |
Recombinant Human Low-density lipoprotein receptor-related protein 2(LRP2),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Zinc finger protein GLI2(GLI2),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Protein disulfide-isomerase A3(PDIA3)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Dog Serum albumin(ALB)
Express system: E.coli
Species: Canis lupus familiaris (Dog) (Canis familiaris)
Recombinant Human T-cell surface glycoprotein CD8 alpha chain(CD8A),partial
Express system: Yeast
Species: Homo sapiens (Human)
Recombinant Human Keratin, type II cytoskeletal 1(KRT1)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Odontogenic ameloblast-associated protein(ODAM)
Express system: E.coli
Species: Homo sapiens (Human)
Recombinant Human Sulfotransferase family cytosolic 2B member 1(SULT2B1)
Express system: E.coli
Species: Homo sapiens (Human)
Wait!
Join the 25,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.
Sign up now!
We don't deal in spam.
