Recombinant Mouse Tumor necrosis factor receptor superfamily member 4(Tnfrsf4)

Code CSB-CF023981MO
Product Type Transmembrane Protein
Size Pls inquiry other sizes
Uniprot No. P47741
Storage Buffer Tris-based buffer,50% glycerol
Species Mus musculus (Mouse)
Sequence VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGPAFAVLLGLGLGLLAPLTVLLALYLLRKAWRLPNTPKPCWGNSFRTPIQEEHTDAHFTLAKI
Source in vitro E.coli expression system
Gene Names Tnfrsf4
Protein Names Recommended name: Tumor necrosis factor receptor superfamily member 4 Alternative name(s): OX40 antigen OX40L receptor CD_antigen= CD134
Expression Region 20-272
Tag Info 10xHis-SUMO-tag
Protein Description Full Length of Mature Protein
Storage Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).
Subcellular Location Membrane, Single-pass type I membrane protein
Database Links

KEGG: mmu:22163

STRING: 10090.ENSMUSP00000030952

UniGene: Mm.13885

Related Products

Tnfrsf4 Antibodies

Tnfrsf4 Antibodies for Mus musculus (Mouse)

Tnfrsf4 Proteins

Tnfrsf4 Proteins for Mus musculus (Mouse)

Tnfrsf4 ELISA Kit

Tnfrsf4 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.