Recombinant Mouse Tumor necrosis factor receptor superfamily member 4(Tnfrsf4),partial

Code CSB-EP023981MO
Product Type Recombinant Protein
Size US$2466
Uniprot No. P47741
Relevance Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias OX40 antigen OX40L receptor CD_antigen: CD134
Species Mus musculus (Mouse)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Research Area Others
Source E.coli
Gene Names Tnfrsf4
Expression Region 20-211aa
Tag Info N-terminal 6xHis-SUMO-tagged
Mol. Weight 37.3kDa
Protein Description Partial
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Function Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity (By similarity).
Subcellular Location Membrane, Single-pass type I membrane protein
Database Links

KEGG: mmu:22163

STRING: 10090.ENSMUSP00000030952

UniGene: Mm.13885

Related Products

Tnfrsf4 Antibodies

Tnfrsf4 Antibodies for Mus musculus (Mouse)

Tnfrsf4 Proteins

Tnfrsf4 Proteins for Mus musculus (Mouse)

Tnfrsf4 ELISA Kit

Tnfrsf4 ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.