Recombinant Mouse Tumor necrosis factor receptor superfamily member 4 (Tnfrsf4), partial

Code CSB-EP023981MO
Abbreviation Recombinant Mouse Tnfrsf4 protein, partial
MSDS
Size US$306
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Others
Alternative Names
Tnfrsf4; Ox40; Txgp1; Tumor necrosis factor receptor superfamily member 4; OX40 antigen; OX40L receptor; CD antigen CD134
Species
Mus musculus (Mouse)
Source
E.coli
Expression Region
20-211aa
Target Protein Sequence
VTARRLNCVKHTYPSGHKCCRECQPGHGMVSRCDHTRDTLCHPCETGFYNEAVNYDTCKQCTQCNHRSGSELKQNCTPTQDTVCRCRPGTQPRQDSGYKLGVDCVPCPPGHFSPGNNQACKPWTNCTLSGKQTRHPASDSLDAVCEDRSLLATLLWETQRPTFRPTTVQSTTVWPRTSELPSPPTLVTPEGP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
37.3kDa
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Receptor for TNFSF4/OX40L/GP34. Is a costimulatory molecule implicated in long-term T-cell immunity.
Gene References into Functions
  1. Crucial role of OX40/OX40L signaling in a murine model of asthma has been demonstrated. PMID: 29344664
  2. Combination therapies that depend on checkpoint inhibitor antibodies (Abs) such as for PD-1 or its ligand (PD-L1) together with immune stimulatory agonist Abs like anti-OX40 are being tested in the clinic to achieve improved antitumor effects PMID: 28848055
  3. High Fat Diet-induced obese mice exhibit increased OX40 expression in adipose tissues and splenic T cells. PMID: 28612217
  4. These data support the hypothesis that the Ox40/Ox40L pathway drives cellular and humoral autoimmune responses during lupus nephritis in NZB/W F1 mice and emphasize the potential clinical value of targeting this pathway in human lupus. PMID: 28696253
  5. OX40 is a death receptor for invariant natural killer T cells and is implicated in pyroptotic cell death. PMID: 28436935
  6. this study shows that OX40 links a costimulatory receptor to a repressive chromatin remodeling pathway, and that that OX40 stimulation inhibits IL-17 and reduces experimental autoimmune encephalomyelitis PMID: 27317259
  7. IFNalphaR1 signaling promoted CXCL9 and CXCL10 synthesis, suggesting that these chemokines might be involved in the LPS and CD134 costimulation response. PMID: 28432083
  8. OX40 and ICOS act in a cooperative, nonredundant manner to maximize and prolong the T follicular helper cell response that is generated after acute virus infection PMID: 27895177
  9. OX40 regulates cardiac remodelling via the modulation of CD4(+) T-lymphocytes. PMID: 27580926
  10. bone marrow-derived mast cell (BMMC)-exosomes facilitated the differentiation of naive CD4+ T cells to Th2 cells by ligation of OX40L and OX40 between BMMC-exosomes and CD4+ T cells and represents a novel mechanism of cell-to-cell communication PMID: 27066504
  11. Crystal structures and NMR data show that the Roquin-1 ROQ domain recognizes hexaloops in the SELEX-derived alternative decay element (ADE) and in an ADE-like variant present in the Ox40 3'-UTR with identical binding modes. PMID: 27010430
  12. The OX40-OX40 ligand interaction up-regulates intracellular levels of reactive oxygen species in atherogenesis. PMID: 25115246
  13. OX40 was highly expressed by intratumoral T cells, particularly those of the FoxP3(+) regulatory T-cell (Treg) lineage. PMID: 24732076
  14. OX40 and IL-7 play synergistic, but distinct roles in the homeostatic proliferation of CD4(+) effector memory T cells PMID: 25103720
  15. OX40-OX40L interaction regulates the expression of NFATc1, which may play a critical role in atherosclerotic plaque formation, and may therefore have implications with pathophysiology of atherosclerosis. PMID: 24045961
  16. OX40 stimulation of virus-specific CD4 T cells promoted expression of the transcriptional repressor Blimp-1 and diverted the majority of cells away from follicular Th cell differentiation. PMID: 24101548
  17. interruption of the OX40-OX40L signaling pathway, with decreases in dietary cholesterol, induces regression of atherosclerosis by induction of IL-5-producing T cells and oxidized low-density lipoprotein-specific IgM and reductions in Th2 and mast cells. PMID: 24068673
  18. OX40-OX40L interaction promotes proliferation and activation of lymphocytes via NFATc1 in ApoE-deficient mice. PMID: 23593329
  19. These data show that OX40-OX40L signaling contributes to the evolution of the adaptive immune response to an allograft via the differential control of alloreactive effector and regulatory T cell survival. PMID: 23817421
  20. These results suggest that OX40 costimulation crucially engages survivin during antigen-mediated Th2 responses PMID: 23616302
  21. mediates responsiveness to respiratory syncytial virus in neonates PMID: 23036746
  22. OX40 facilitates control of a persistent virus infection. PMID: 22969431
  23. Mechanistically, OX40 activated the ubiquitin ligase TRAF6, which triggered induction of the kinase NIK in CD4( ) T cells and the noncanonical transcription factor NF-kappaB pathway; this subsequently led to the generation of T(H)9 cells. PMID: 22842344
  24. Both TNFRSF4 and TNFRSF25 independently and additively costimulate vaccine-induced CD8+ T cell proliferation following both primary and secondary antigen challenge. PMID: 22956587
  25. OX40 (CD134), after ligation by OX40L, assembles a unique complex that not only contains TRAF2, RIP, and IKKalpha/beta/gamma but also CARMA1, MALT1, BCL10, and PKC, molecules previously shown to regulate NF-kappaB activation through the T-cell receptor (TCR). PMID: 21282629
  26. OX40-OX40L interaction can regulate the mRNA and protein expressions of NFATc1 in lymphocytes of ApoE-/- mice. PMID: 21924079
  27. Development of skin lesions was rather more likely explained by deletion of Ikbk2 in skin keratinocytes in OX40(Cre) mice. PMID: 22363815
  28. following OX40 stimulation, blockade of Treg-cell suppression and enhancement of the Tem-cell adjuvant effect both concurred to free DCs from immunosuppression and activate the immune response against the tumor. PMID: 22229156
  29. OX40L and PD-L2 expressed on dendritic cells differentially regulate cytokine production during recall responses in the lung. PMID: 22266281
  30. OX40 engagement in vivo in naive mice induces initial expansion of Foxp3+ regulatory T (Treg) cells, but the expanded Tregs have poor suppressive function and exhibit features of exhaustion which can be prevented by exogenous interleukin (IL)-2. PMID: 22147766
  31. sOX40 inhibits MC degranulation, it may provide an in vivo therapeutic tool in allergic disease. PMID: 21653238
  32. Mxd4 and Mnt upregulation following OX40 engagement most likely increases T-cell survival PMID: 21400495
  33. The vascular OX40/OX40L system plays an important role in the formation of vasa vasorum and subsequent atherosclerosis PMID: 20584752
  34. Activation of OX40 augments Th17 cell function and thereby contributes to ocular inflammation. PMID: 20952591
  35. OX40 is a key factor in shaping Treg sensitivity to IL-2 and promoting cell proliferation and survival. PMID: 20806292
  36. OX40 on not only CD4(+) T cells but also NKT cells is involved in allergic airway inflammation. PMID: 20019337
  37. OX40 plays a key role in the homeostasis of intestinal Foxp3+ T regulatory cells and in suppression of colitis. PMID: 20368580
  38. find that OX40, a marker of both T cell activation and memory, is selectively upregulated in the brain during ECM and its distribution among CD4(+) and CD8(+) T cells accumulated in the brain vasculature is approximately equal PMID: 19710907
  39. role in activation of CD8(+) intraepithelial lymphocytes PMID: 11739485
  40. Engagement of OX40 enhances antigen-specific CD4(+) T cell mobilization/memory development and humoral immunity PMID: 11739496
  41. Dendritic cell-induced CD4+ and CD8+ T cell responses in vivo are strongly amplified when Ox40 signaling is provided through an anti-Ox40 monoclonal antibody. PMID: 11777959
  42. Constitutive interaction of OX40 with its ligand provides a system that plays a potential key role in the immune regulation of various autoimmune diseases. PMID: 12370402
  43. relative importance of CD134 (OX40) and CD137 (4-1BB) in the costimulation of CD4+ and CD8+ T cells under comparable conditions of antigenic stimulation PMID: 12516549
  44. The OX40/OX40L pathway has a broad importance in graft-versus-host disease induction. PMID: 12521997
  45. T-cell stimulation via OX40 engagement during cryptococcosis infection using OX40L fusion protein (OX40L:Ig) promotes cell-mediated immunity and IFN-gamma production by CD4+ T cells, and reduces pathogen burden in the lung and associated eosinophilia. PMID: 12794142
  46. expressed on memory CD4 cells; OX40-OX40L interactions are pivotal to the efficiency of recall responses regulated by memory Th2 cells PMID: 12860930
  47. Interactions mediated by CD134 affect onset and development of experimental allergic encephalomyelitis; Cd134-/- mice show less severe clinical signs of disease and markedly reduced inflammatory infiltrates within the central nervous system. PMID: 14644025
  48. OX40 signals may play a key role in mediating skin allograft rejection in CD28/CD154 double knockout mice. PMID: 14734751
  49. Important roles are revealed for OX40 signals in regulatory T (Treg) cell development, homeostasis, and suppressive activity, showing how OX40 signals can oppose Treg mediated suppression when they are delivered directly to antigen-engaged naive T cells. PMID: 15004159
  50. OX40 is one of the costimulatory molecules that can contribute signals to regulate the accumulation of antigen-reactive CD8 cells during immune responses. PMID: 15067059

Show More

Hide All

Subcellular Location
Membrane; Single-pass type I membrane protein.
Tissue Specificity
Expressed in CD4(+) T-cells and in T-helper Th17 cells (at protein level).
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*