Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
The ED50 as determined by its ability to inhibit IL-8 secretion in A431 human epithelial carcinoma cells is less than 50 ng/ml.
Alternative Names
FIL1; FIL1 epsilon; FIL1(EPSILON); FIL1E; IL 1 epsilon; IL 1F6; IL 1H1; IL-1 epsilon; IL-1F6; IL1E; IL1F6; IL1F6_HUMAN; IL1RP2; IL36 alpha; IL36A; Interleukin 1 epsilon; Interleukin 1 family member 6 (epsilon); Interleukin 1 family member 6; Interleukin 36 alpha; Interleukin-1 epsilon; Interleukin-1 family member 6; MGC129552; MGC129553; MGC151479; MGC151481; OTTMUSP00000012798; RP23-176J12.4
Species
Homo sapiens (Human)
Expression Region
1-158aa
Complete Sequence
MEKALKIDTPQQGSIQDINHRVWVLQDQTLIAVPRKDRMSPVTIALISCRHVETLEKDRGNPIYLGLNGLNLCLMCAKVGDQPTLQLKEKDIMDLYNQPEPVKSFLFYHSQSGRNSTFESVAFPGWFIAVSSEGGCPLILTQELGKANTTDFGLTMLF
Protein Length
Full Length
Buffer
Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
