Recombinant Mouse Interleukin-17A (Il17a), partial (Active)

In Stock
Code CSB-AP004781MO
MSDS
Size $204
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 0.01 EU/µg as determined by LAL method.
Activity
The ED50 as determined by its ability to induce IL-6 secretion by NIH‑3T3 mouse embryonic fibroblast cells is 0.25-1.25 ng/ml.
Target Names
Uniprot No.
Research Area
Immunology
Alternative Names
Il17a; Ctla8; Il17; Interleukin-17A; IL-17; IL-17A; Cytotoxic T-lymphocyte-associated antigen 8; CTLA-8
Species
Mus musculus (Mouse)
Source
Mammalian cell
Expression Region
22-158aa
Complete Sequence
TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Mol. Weight
16.2 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered solution of PBS,PH7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Effector cytokine of innate and adaptive immune system involved in antimicrobial host defense and maintenance of tissue integrity. Signals via IL17RA-IL17RC heterodimeric receptor complex, triggering homotypic interaction of IL17RA and IL17RC chains with TRAF3IP2 adapter. This leads to downstream TRAF6-mediated activation of NF-kappa-B and MAPkinase pathways ultimately resulting in transcriptional activation of cytokines, chemokines, antimicrobial peptides and matrix metalloproteinases, with potential strong immune inflammation. Plays an important role in connecting T cell-mediated adaptive immunity and acute inflammatory response to destroy extracellular bacteria and fungi. As a signature effector cytokine of T-helper 17 cells (Th17), primarily induces neutrophil activation and recruitment at infection and inflammatory sites. In airway epithelium, mediates neutrophil chemotaxis via induction of CXCL1 and CXCL5 chemokines. In secondary lymphoid organs, contributes to germinal center formation by regulating the chemotactic response of B cells to CXCL12 and CXCL13, enhancing retention of B cells within the germinal centers, B cell somatic hypermutation rate and selection toward plasma cells. Effector cytokine of a subset of gamma-delta T cells that functions as part of an inflammatory circuit downstream IL1B, TLR2 and IL23A-IL12B to promote neutrophil recruitment for efficient bacterial clearance. Effector cytokine of innate immune cells including invariant natural killer cell (iNKT) and group 3 innate lymphoid cells that mediate initial neutrophilic inflammation. Involved in the maintenance of the integrity of epithelial barriers during homeostasis and pathogen infection. Upon acute injury, has a direct role in epithelial barrier formation by regulating OCLN localization and tight junction biogenesis. As part of the mucosal immune response induced by commensal bacteria, enhances host's ability to resist pathogenic bacterial and fungal infections by promoting neutrophil recruitment and antimicrobial peptides release. In synergy with IL17F, mediates the production of antimicrobial beta-defensins DEFB1, DEFB103A, and DEFB104A by mucosal epithelial cells, limiting the entry of microbes through the epithelial barriers. Involved in antiviral host defense through various mechanisms. Enhances immunity against West Nile virus by promoting T cell cytotoxicity. May play a beneficial role in influenza A virus (H5N1) infection by enhancing B cell recruitment and immune response in the lung. Contributes to influenza A virus (H1N1) clearance by driving the differentiation of B-1a B cells, providing for production of virus-specific IgM antibodies at first line of host defense.
Gene References into Functions
  1. gammadeltaT17 cells constitutively express chemokine receptors CCR6 and CCR2 PMID: 28580944
  2. this paper shows that IL-17-driven intestinal fibrosis is inhibited by Itch-mediated ubiquitination of HIC-5 PMID: 28612841
  3. this study shows that IL-17A negatively regulates lymphangiogenesis in T helper 17 cell-mediated inflammation PMID: 28930285
  4. The present study demonstrated that a high fat diet induces IL-17A expression, which exacerbates the progression of nonalcoholic fatty liver disease by inhibiting fatty acid beta-oxidation and promoting the accumulation of triglycerides (TG). PMID: 28153707
  5. JunB has an essential role in IL-23-dependent pathogenicity of Th17 cells PMID: 28555647
  6. Gamma-delta T cells are a prime source of protumoral IL17A in breast cancer. PMID: 29070614
  7. blocking activin/ACVR2A impaired the potency of hepatic stellate cells to produce collagens in response to IL17s. PMID: 29620144
  8. this study shows the positive effects of IL-17 on the early-stage differentiation and negative effects on the calcification of primary osteoblasts in vitro PMID: 29438885
  9. these data suggest that IL-17A promotes DVT pathogenesis by enhancing platelet activation and aggregation, neutrophil infiltration, and EC activation PMID: 29482157
  10. These findings highlight a regulatory pathway of Tiam1/Rac1 in Th17 cells and suggest that it may be a therapeutic target in multiple sclerosis. PMID: 27725632
  11. DAPK deficiency leads to excess HIF-1a accumulation, enhanced IL-17 expression and exacerbated experimental autoimmune encephalomyelitis. PMID: 27312851
  12. decreased COX-2 and IL-17 levels were observed in both groups treated with Nintedanib in the prostate anterior lobe. Thus, we concluded that Nintedanib was effective in delaying tumor progression and, despite not directly acting on inflammation, Nintedanib may adversely affect inflammatory pathways, favoring prostate cancer delay PMID: 29429524
  13. In studies of mouse and human pancreatic tumors and precursors, we found that immune cell-derived IL17 regulated development of tuft cells and stem cell features of pancreatic cancer cells via increased expression of DCLK1, POU2F3, ALDH1A1, and IL17RC. PMID: 29604293
  14. The reaction of IL-17A in the acute lung injury induced by LPS is stronger than that by PQ. PMID: 28600744
  15. IL17A promoted osteoblast differentiation and calcification in a partly AKT2dependent manner in MC3T3E1 cells in vitro, possibly reflecting compensation by other signaling pathways. The results of the present study may offer novel perspectives to guide the clinical strategy for the prevention and treatment of periodontitis PMID: 28849233
  16. Mechanistically, CREB, activated by CD3-PKC- signaling, plays a key role in regulating Th17 cell differentiation, at least in part through directly binding to the Il17-Il17f gene locus. PMID: 29050947
  17. Data show that interleukin-17 (IL-17) and fungal candidalysin amplify inflammation in a self-reinforcing feed-forward loop. PMID: 29101209
  18. The data indicate that IL-17A contributes to augmented responses to ozone in db/db mice. Furthermore, IL-17A appears to act at least in part by inducing expression of gastrin-releasing peptide receptor. PMID: 28957638
  19. miR203 expression may be upregulated by IL17 stimulation, and miR203 is a positive regulator of IL17induced VEGF secretion. PMID: 29039484
  20. IL-17 contributes to lung obliterative bronchiolitis pathogenesis through regulating macrophages function PMID: 28863322
  21. we demonstrate that gammadelta T cells and CD4+ T (Th17) cells are the two major producers of IL-17A in the lung at the early and later stages of chlamydial infection, respectively PMID: 27796286
  22. In mice on a C57BL/6 background, neither IL-23p19 nor IL-17A plays a role for immune protection against L. major in the physiological context of natural infections. PMID: 27297018
  23. IL-17A and IL-17F exert distinct biological effects during pulmonary infection; the IL-17F/IL-17RC signaling axis has the potential to significantly worsen pathogen-associated inflammation of the lower respiratory tract. PMID: 28813677
  24. TLR2/4-mediated IL-17A inflammatory signaling is involved in vessel degeneration and revascularization, indicating that modulation of the TLR2/4-IL-17A pathway may be a novel therapeutic strategy for degenerative diseases. PMID: 27297042
  25. The hormone levels are significantly reduced and lymphocytic infiltration in the lacrimal gland in ovariectomized mice, whereas the frequency of Th17 cells in the blood and spleen and IL-17A and IL-23 expression in the lacrimal glands are increased, leading to reduced tear production and positive fluorescein staining in the cornea. PMID: 27341090
  26. the results suggest that IL-17A induces podocyte injury by activating the NLRP3 inflammasome and IL-1beta secretion and contributes to disruption of the kidney's filtration system. PMID: 29446486
  27. These results suggest that a low concentration of IL-17A is likely to promote autophagic activity via activating RANKL-JNK pathway during osteoclastogenesis. PMID: 29476739
  28. study shows that IL-17A plays an important role in comorbid depression associated with psoriatic inflammation, where both NFkappaB and p38MAPK pathways play significant roles via upregulation of inflammatory mediators in the brain PMID: 28570931
  29. the present study demonstrated that IL-17A crucially regulated the wound healing process and that accelerated neutrophil accumulation caused by IL-17A led to the delayed wound repair. PMID: 27305096
  30. The results emphasize the importance of IL-17 in experimental autoimmune myasthenia gravis development and that IL-17 independent pathways drive the autoimmune reaction. PMID: 28599246
  31. In estrogen receptor negative breast cancer cells targeting of IL-17A inhibited PDL1 expression in the tumor microenvironment, decreasing the percentage of Treg cells in tumor-infiltrating lymphocytes, and promoting CD4+ and CD8+ T cells to secrete interferon gamma. PMID: 27935862
  32. Report provides evidence that IL-17 can promote Lewis lung carcinoma growth through inhibition of myeloid-derived suppressor cells apoptosis, which maybe dependent on ERK1/2 signaling pathway. PMID: 28002798
  33. these data provide novel insight into a dynamic IL-17A-CXCR2-neutrophil axis during acute segmented filamentous bacteria colonization and demonstrate a central role for neutrophils in limiting segmented filamentous bacteria expansion PMID: 27624780
  34. Transient AIEC colonization in IL-17 KO mice resulted in increased intestinal epithelial damage, systemic bacterial burden and mortality compared with controls. IL-17 is required for the induction of IL-22 during AIEC strain E. coli LF82 colonization. IL-17 plays a protective role in AIEC strain E. coli LF82 induced colitis by promoting IL-22 secretion. PMID: 29195141
  35. after orthotopic lung transplantation, in the IL-17A KO group, less inflammation in the bronchovascular axis was observed and a non-significant trend towards less bronchovascular fibrosis, pleural/septal inflammation and fibrosis, and parenchymal inflammation and fibrosis when compared to WT mice PMID: 27737799
  36. Data show that IL-17 in the serum of collagen-induced arthritis (CIA) mice was markedly increased on day 14 and reached its apogee on day 27. PMID: 27356747
  37. this study unveiled the role of IL-23-dependent IL-17 induction in LdCen-/- parasite-induced immunity and subsequent protection against visceral leishmaniasis PMID: 29187586
  38. There was a significantly decreased percentage of IL-17A-producing CD4 T cells in mice receiving Tregs from xIAP mice. xIAP appears dispensable for the generation of induced Treg cells as well as function of natural Treg cells. There appeared to be a role of xIAP in generation of IL-17-producing cells from either naive CD4 T cells or Treg cells. PMID: 26825770
  39. astrocytic IL-17A plays important roles in the maintenance of neuropathic pain through CaMKII/CREB signaling pathway in spinal cord. PMID: 26166359
  40. Results reveal the importance of the IL-23/IL-17 inflammatory axis in secondary brain injury after intracerebral hemorrhage. PMID: 27729335
  41. these results demonstrate an important role of CXCR6 in the regulation of pathological Th17 and IL-17A(+)TCRgammadelta(+) T-cell recruitment into atherosclerotic lesions. PMID: 26614640
  42. These results suggest that IL-17A plays an important role in host survival against Toxoplasma gondii infection by protecting the host from an anaphylactic reaction via the downregulation of Toxoplasma gondii HSP70 and IFN-gamma production. PMID: 28893913
  43. These results suggest that AKI after septic shock is driven through IL-17 release by Th17 cells; this is gradually consumed in the kidney. PMID: 27515003
  44. IL-17A markedly induced VEGF and IL-6 expression in the Raw264.7 murine macrophage cell line and in the mouse corneal fibroblasts. PMID: 27419340
  45. Vgamma4 T cells accelerate skin graft rejection by providing an early source of IL-17A PMID: 28733202
  46. IL-17 inhibits adipogenesis where a lack of IL-17 ameliorates glucose metabolism. As well, the inhibition of TBK1 reduces inflammation induced by IL-17. Therefore, IL-17 may be involved in the development of obesity and metabolic dysfunction in a TBK1-dependent manner. PMID: 28237848
  47. Th17 cells and TGFbeta1 are not required for the maintenance of gammadelta T cells producing interleukin-17A cells. PMID: 27649780
  48. Data show that inducible T cell co-stimulator (ICOS) deficient mice have a significant increase in the population of IL-17-producing Vgamma2+ gammadelta T cells in the thymus, spleen, lymph nodes and skin and exhibit exacerbated sensitization responses to 2,4-dinitrofluorobenzene. PMID: 27235509
  49. the majority of gammadelta T cells in the non-pregnant uterus, pregnant uterus, decidua and placenta of mice express the transcription factor RORgammat and produce interleukin-17 (IL-17). PMID: 27241697
  50. In both the high-glucose - treated Muller cells and Akita mouse retina, the Act1/TRAF6/IKK/NF-kappaB signaling pathway was activated. IL-17A further enhanced inflammatory signaling activation, whereas Act1 knockdown or IKK inhibition blocked the downstream signaling activation by IL-17A. PMID: 27980343

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
IL-17 family
Tissue Specificity
Expressed by Th17 cell lineage (at protein level). The expression pattern reflects the differentiation state, with IL17A-IL17F heterodimers produced at higher levels than IL17A-IL17A and IL17F-IL17F dimers in fully differentiated Th17 cells. Expressed in
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2024 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*