Recombinant Mouse Interleukin-17A(Il17a),partial

In Stock
Code CSB-AP004781MO
Product Type Interleukin
Size US$137Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q62386
Lead Time 5-10 business days
Storage Buffer Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4
Alias Interleukin-17A; IL-17; IL-17A; Cytotoxic T-Lymphocyte-Associated Antigen 8; CTLA-8; IL17A; CTLA8; IL17
Species Mus musculus (Mouse)
Biological_Activity The ED50 as determined by its ability to induce IL-6 secretion by NIH?3T3 mouse embryonic fibroblast cells is less than 200 ng/ml.
Purity Greater than 95% as determined by SDS-PAGE.
Endotoxin Less than 1.0 EU/μg as determined by LAL method.
Sequence TVKAAAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
Research Area Immunology
Source Mammalian cell
Gene Names Il17a
Expression Region 22-158aa
Tag Info C-terminal 6xHis-tagged
Mol. Weight 16.2 kDa
Protein Description Partial
Still Have Questions? Leave a Message or Start an on-line Chat
Function Ligand for IL17RA
Subcellular Location Secreted
Protein Families IL-17 family
Tissue Specificity Restricted to a subset of activated T-cells.
Database Links

KEGG: mmu:16171

STRING: 10090.ENSMUSP00000027061

UniGene: Mm.5419

Pathway IL-17 signaling pathway
Th17 cell differentiation

Related Products

Il17a Proteins

Il17a Proteins for Mus musculus (Mouse)

Il17a ELISA Kit

Il17a ELISA Kit for Mus musculus (Mouse)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.