Recombinant Human Activin receptor type-2B (ACVR2B), partial (Active)

In Stock
Code CSB-AP005701HU
Abbreviation Recombinant Human ACVR2B protein, partial (Active)
MSDS
Size $96
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human Activin A at 2μg/ml can bind Human ACVR2B-Fc-His, the ED50 of Recombinant Human ACVR2B-Fc-His is 50-500 ng/ml.
Target Names
Uniprot No.
Research Area
Signal Transduction
Alternative Names
Activin A receptor type IIB; Activin receptor type 2B; Activin receptor type IIB; Activin receptor type-2B; ActR IIB; ACTR-IIB; ActRIIB; ACVR 2B; ACVR2B; AVR2B_HUMAN; HTX4; MGC116908
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
19-134aa
Complete Sequence
SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT
Mol. Weight
41.3 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-hFc-tagged
Form
Liquid or Lyophilized powder
Buffer
Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 10% Trehalose, 3% Mannitol, 0.05% Tween 80, 10 mM Methionine, pH8.5.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.
Datasheet & COA
Please contact us to get it.
Description

ACVR2B plays a central role in TGF-β superfamily signaling by serving as a high-affinity receptor for activins, myostatin, and GDF-11, making it a key target in muscle biology and metabolic disease research. This recombinant human ACVR2B encompasses the extracellular ligand-binding domain (aa 19–134) with a C-terminal His-Fc tag, expressed in mammalian cells to preserve native glycosylation and conformational integrity critical for accurate ligand recognition. Functional ELISA confirms that immobilized Activin A (2 μg/ml) binds this protein with an ED50 of 50–500 ng/ml, providing validated support for receptor-ligand interaction assays, competitive inhibition studies, blocking antibody screening, and use as a positive control in ELISA, SPR, or BLI-based affinity characterization. Purity exceeding 95% by SDS-PAGE combined with endotoxin levels below 1.0 EU/μg satisfies the quality criteria typical for drug discovery screening of small-molecule or biologic inhibitors targeting the activin signaling axis.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

Please confirm if this protein contains any hazardous materials like azide or mercury etc...? if it contains any serum or plasma derived from animals or BSA?

A:

This protein does not contain any hazardous materials like azide or mercury etc. It does not contain any serum or plasma derived from animals or BSA, either.

Q:

Is each lot functionally validated?Is this available tag free or biotinylated avi tagged?

A:

Activity verification will be carried out for each batch to ensure protein activity. A 6xHis-FC tag is fused at the C-terminal.

Q:

Can you disclose which kind of mammalian cell do you use to produce Recombinant Human Activin receptor type-2B(ACVR2B), Cat#.: CSB-AP005701HU?

A:

As for this protein CSB-AP005701HU, the cell line we use is HEK293.

Target Background

Function
Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, the type-2 receptors act as a primary activin receptors (binds activin-A/INHBA, activin-B/INHBB as well as inhibin-A/INHA-INHBA). The type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor.
Gene References into Functions
  1. the A allele of genetic variant rs2276541 in ACVR2B is associated with lean muscle mass PMID: 26848890
  2. ActR-IIB is expressed in male germ cells and Sertoli cells. PMID: 26289399
  3. We found that the AAAAA, AGGAG, and AGGGA haplotypes in ACVR2B were associated with susceptibility to Premature Ovarian Failure when they also had at least one CATAG haplotype in ADAMTS19. PMID: 25051287
  4. miR-21 interacts directly with the 3'-untranslated region of ACVR2B mRNA. Mechanical stretch suppressed ACVR2B protein levels in periodontal ligament stem cells. Gain- and loss of function of ACVR2B mediated the osteogenic differentiation of PDLSCs. PMID: 25203845
  5. Activin type IIB receptors are clearly demonstrable throughout the adult human hypothalamus and basal forebrain. PMID: 22296042
  6. After eccentric exercise, postmenopausal women not using hormone therapy (HT) expressed lower levels of ActRIIb while postmenopausal women using HT showed a heightened response. PMID: 22395277
  7. The interaction between all five miRNAs and ACVR2B was verified by an in vitro assay. PMID: 22431721
  8. Mutations in Activin A Receptor Type IIB were identified in 4 of the 47 patients (8.5%) with heterotaxy syndrome. Our results expand the mutation spectrum of monogenic heterotaxy syndrome with associated cardiac anomalies. PMID: 21864452
  9. discussion of crystal structure of kinase domain of ActRIIB; structural analysis may be of help in developing selective inhibitors [REVIEW] PMID: 21353874
  10. Inhibition of negative regulators of skeletal muscle by a soluble form of activin type IIB receptor (ACE-031) increases muscle mass independent of fiber-type expression. PMID: 20466801
  11. analysis of expression and cellular compartmentalization of the activin receptors ActRIIA, ActRIIB and ActRIB, the inhibin co-receptor (betaglycan), and activin signaling proteins Smads 2, 3 and 4, and growth regulatory role during lactation PMID: 12782414
  12. activin signaling via type II receptors requires a specific sequence for ALK4 binding PMID: 15123686
  13. These results indicate that haplotype structure at the ACVR2B and follistatin loci may contribute to interindividual variation in skeletal muscle mass and strength, although these data indicate sex-specific relationships. PMID: 17347381
  14. The high-resolution structure of human ActRIIB kinase domain in complex with adenine establishes the conserved bilobal architecture consistent with all other catalytic kinase domains. PMID: 17893364

Show More

Hide All

Involvement in disease
Heterotaxy, visceral, 4, autosomal (HTX4)
Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily
Database Links

HGNC: 174

OMIM: 602730

KEGG: hsa:93

STRING: 9606.ENSP00000340361

UniGene: Hs.174273

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*