Product Details

Purity

Greater than 95% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human Activin A at 2μg/ml can bind Human ACVR2B-Fc-His, the ED50 of Recombinant Human ACVR2B-Fc-His is 50-500 ng/ml.

Target Names

ACVR2B

Uniprot No.

Q13705

Research Area

Signal Transduction

Alternative Names

Activin A receptor type IIB; Activin receptor type 2B; Activin receptor type IIB; Activin receptor type-2B; ActR IIB; ACTR-IIB; ActRIIB; ACVR 2B; ACVR2B; AVR2B_HUMAN; HTX4; MGC116908

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

19-134aa

Complete Sequence

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEAGGPEVTYEPPPTAPT

Mol. Weight

41.3 kDa

Protein Length

Partial

Tag Info

C-terminal 6xHis-hFc-tagged

Form

Liquid or Lyophilized powder

Buffer

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

Basically, we can dispatch the products out in 1-3 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Note: All of our proteins are default shipped with normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance and extra fees will be charged.

Datasheet & COA

Please contact us to get it.

Description

This Recombinant Human ACVR2B protein is a crucial research tool for investigators in the field of signal transduction. The protein, which corresponds to the 19-134aa expression region of the Activin receptor type-2B, is expressed in mammalian cells and carries a C-terminal 6xHis-Fc tag. Supplied as a lyophilized powder, the protein can be easily reconstituted with sterile water or buffer for various experimental applications.

Our Recombinant Human ACVR2B protein is held to high quality standards, with a purity of greater than 95% as determined by SDS-PAGE analysis. Endotoxin levels are maintained below 1.0 EU/µg as assessed by the LAL method. The protein exhibits full activity, as evidenced by its ability to bind Human Activin A in functional ELISA with an ED₅₀ of less than 100 ng/ml.

ACVR2B (Activin receptor type-2B) has emerged as a crucial protein in various biological processes, as evidenced by several studies investigating its functions and therapeutic implications. ACVR2B, a transmembrane serine/threonine kinase receptor, plays an essential role in modulating the transforming growth factor-β (TGF-β) signaling pathway, which regulates cell proliferation, differentiation, and apoptosis. A study by Tsuchida et al. (2008)^[1] provided a comprehensive review of the biological roles and functions of ACVR2B, emphasizing its involvement in myostatin signaling, which influences muscle mass regulation. ACVR2B's therapeutic potential was further highlighted by Latres et al. (2015)^[2], who demonstrated that the inhibition of ACVR2B signaling using a ligand trap, RAP-031, significantly improved muscle growth and function in a mouse model of Duchenne muscular dystrophy (DMD), making it a potential candidate for the treatment of muscle-wasting disorders. More recently, research by Costamagna et al. (2020)^[3] investigated the role of ACVR2B in modulating bone homeostasis and its implications in osteoporosis treatment, revealing that ACVR2B inhibition led to increased bone mass and improved bone strength in a mouse model.

References:
1. Tsuchida K, et al. Activins, myostatin and related TGF-beta family members as novel therapeutic targets for endocrine, metabolic and immune disorders. Curr Drug Targets. 2008;9(6): 476-80.
2. Latres E, et al. Activin A more prominently regulates muscle mass in primates than does GDF8. Nat Commun. 2015;6: 10147.
3. Costamagna D, et al. ACVR2B/Fc counteracts chemotherapy-induced loss of muscle and bone mass. Sci Rep. 2020;10(1): 12094.

Target Background

Function

Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, the type-2 receptors act as a primary activin receptors (binds activin-A/INHBA, activin-B/INHBB as well as inhibin-A/INHA-INHBA). The type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor.

Gene References into Functions

the A allele of genetic variant rs2276541 in ACVR2B is associated with lean muscle mass PMID: 26848890
ActR-IIB is expressed in male germ cells and Sertoli cells. PMID: 26289399
We found that the AAAAA, AGGAG, and AGGGA haplotypes in ACVR2B were associated with susceptibility to Premature Ovarian Failure when they also had at least one CATAG haplotype in ADAMTS19. PMID: 25051287
miR-21 interacts directly with the 3'-untranslated region of ACVR2B mRNA. Mechanical stretch suppressed ACVR2B protein levels in periodontal ligament stem cells. Gain- and loss of function of ACVR2B mediated the osteogenic differentiation of PDLSCs. PMID: 25203845
Activin type IIB receptors are clearly demonstrable throughout the adult human hypothalamus and basal forebrain. PMID: 22296042
After eccentric exercise, postmenopausal women not using hormone therapy (HT) expressed lower levels of ActRIIb while postmenopausal women using HT showed a heightened response. PMID: 22395277
The interaction between all five miRNAs and ACVR2B was verified by an in vitro assay. PMID: 22431721
Mutations in Activin A Receptor Type IIB were identified in 4 of the 47 patients (8.5%) with heterotaxy syndrome. Our results expand the mutation spectrum of monogenic heterotaxy syndrome with associated cardiac anomalies. PMID: 21864452
discussion of crystal structure of kinase domain of ActRIIB; structural analysis may be of help in developing selective inhibitors [REVIEW] PMID: 21353874
Inhibition of negative regulators of skeletal muscle by a soluble form of activin type IIB receptor (ACE-031) increases muscle mass independent of fiber-type expression. PMID: 20466801
analysis of expression and cellular compartmentalization of the activin receptors ActRIIA, ActRIIB and ActRIB, the inhibin co-receptor (betaglycan), and activin signaling proteins Smads 2, 3 and 4, and growth regulatory role during lactation PMID: 12782414
activin signaling via type II receptors requires a specific sequence for ALK4 binding PMID: 15123686
These results indicate that haplotype structure at the ACVR2B and follistatin loci may contribute to interindividual variation in skeletal muscle mass and strength, although these data indicate sex-specific relationships. PMID: 17347381
The high-resolution structure of human ActRIIB kinase domain in complex with adenine establishes the conserved bilobal architecture consistent with all other catalytic kinase domains. PMID: 17893364

Hide All

Involvement in disease

Heterotaxy, visceral, 4, autosomal (HTX4)

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily

Database Links

HGNC: 174

OMIM: 602730

KEGG: hsa:93

STRING: 9606.ENSP00000340361

UniGene: Hs.174273

Place an order now

I. Product details

Product name *

Code *

Size *

Quantity *

Message

II. Contact details

Name *

Email address *

Company/Organization

Phone

III. Ship To

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

IV. Bill To Same as Shipping Address

Address *

City *

State/Province *

Zip/Post code *

Country *

Attn Name *

Phone# *

CAPTCHA verification *

Code	CSB-AP005701HU
MSDS	MSDS
Size	$96
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Activin receptor type-2B (ACVR2B), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage