Recombinant Human CD276 antigen (CD276), partial (Active)

In Stock
Code CSB-MP733578HU(F2)
Abbreviation Recombinant Human CD276 protein, partial (Active)
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized human CD276 at 2 μg/ml can bind Anti-CD276 recombinant antibody(CSB-RA733578MA1HU). The EC50 is 47.12-54.16 ng/mL. Biological Activity Assay
  • The purity of CD276 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human CD276 at 2 μg/mL can bind Anti-CD276 recombinant antibody(CSB-RA733578MA1HU). The EC50 is 47.12-54.16 ng/mL.
Target Names
Uniprot No.
Alternative Names
4Ig-B7-H3; B7 homolog 3 (B7-H3); Costimulatory molecule; CD276
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-245aa
Target Protein Sequence
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Mol. Weight
24.7 kDa
Protein Length
Partial of Isoform 2
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

CD276 (B7-H3) functions as an immune checkpoint molecule with context-dependent co-stimulatory or co-inhibitory roles in T-cell activation, making it a target of interest in cancer immunotherapy research. This mammalian-expressed construct spanning residues 29–245 of isoform 2 captures the first two immunoglobulin-like domains, preserving the native glycosylation and folding required for authentic receptor-antibody interactions. Functional ELISA validation demonstrates specific binding to an anti-CD276 recombinant antibody with an EC50 of 47.12–54.16 ng/mL, providing quantitative evidence that this protein supports therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation assays. The combination of >95% purity and <1.0 EU/μg endotoxin meets the quality thresholds commonly required for surface plasmon resonance affinity characterization, biolayer interferometry kinetic studies, and use as a positive control in immune checkpoint binding assays.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
No. 269, Shendun 5th Road, Donghu Hi-Tech Development Area, Hubei Province, 430206, P.R.China
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*