Purity

≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.

Activity

Measured by its binding ability in a functional ELISA. Immobilized human CD276 at 2 μg/mL can bind Anti-CD276 recombinant antibody(CSB-RA733578MA1HU). The EC50 is 47.12-54.16 ng/mL.

Target Names

CD276

Uniprot No.

Q5ZPR3-2

Alternative Names

4Ig-B7-H3; B7 homolog 3 (B7-H3); Costimulatory molecule; CD276

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

29-245aa

Target Protein Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP

Mol. Weight

24.7 kDa

Protein Length

Partial of Isoform 2

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

CD276 (B7-H3) functions as an immune checkpoint molecule with context-dependent co-stimulatory or co-inhibitory roles in T-cell activation, making it a target of interest in cancer immunotherapy research. This mammalian-expressed construct spanning residues 29–245 of isoform 2 captures the first two immunoglobulin-like domains, preserving the native glycosylation and folding required for authentic receptor-antibody interactions. Functional ELISA validation demonstrates specific binding to an anti-CD276 recombinant antibody with an EC50 of 47.12–54.16 ng/mL, providing quantitative evidence that this protein supports therapeutic antibody epitope mapping, competitive inhibition screening, and blocking antibody validation assays. The combination of >95% purity and <1.0 EU/μg endotoxin meets the quality thresholds commonly required for surface plasmon resonance affinity characterization, biolayer interferometry kinetic studies, and use as a positive control in immune checkpoint binding assays.

Code	CSB-MP733578HU(F2)
Abbreviation	Recombinant Human CD276 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$118
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized human CD276 at 2 μg/ml can bind Anti-CD276 recombinant antibody(CSB-RA733578MA1HU). The EC₅₀ is 47.12-54.16 ng/mL. Biological Activity Assay The purity of CD276 was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human CD276 antigen (CD276), partial (Active)

Product Details

Customer Reviews and Q&A

×CloseMessage