Recombinant Human CD276 antigen (CD276), partial (Active)

In Stock
Code CSB-MP733578HU(F2)
Abbreviation Recombinant Human CD276 protein, partial (Active)
MSDS
Size $118
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized human CD276 at 2 μg/ml can bind Anti-CD276 recombinant antibody(CSB-RA733578MA1HU). The EC50 is 47.12-54.16 ng/mL. Biological Activity Assay
  • The purity of CD276 was greater than 95% as determined by SEC-HPLC
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Greater than 95% as determined by SEC-HPLC.
Activity
Measured by its binding ability in a functional ELISA. Immobilized human CD276 at 2 μg/mL can bind Anti-CD276 recombinant antibody(CSB-RA733578MA1HU). The EC50 is 47.12-54.16 ng/mL.
Target Names
Uniprot No.
Alternative Names
4Ig-B7-H3; B7 homolog 3 (B7-H3); Costimulatory molecule; CD276
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
29-245aa
Target Protein Sequence
LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
Mol. Weight
24.7 kDa
Protein Length
Partial of Isoform 2
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.
Description

This recombinant human CD276 protein is a biologically active form produced in mammalian cells, ensuring proper folding and post-translational modifications. It contains the partial extracellular domain spanning amino acids 29 to 245 and is fused with a C-terminal 10xHis tag to facilitate purification and detection. This recombinant CD276 protein shows high purity, with levels exceeding 95% as confirmed by both SDS-PAGE and SEC-HPLC. Functional validation was performed using ELISA, where CD276 immobilized at 2 μg/mL demonstrated specific binding to the anti-CD276 recombinant antibody (CSB-RA733578MA1HU), yielding an EC50 in the range of 47.12 to 54.16 ng/mL. These characteristics make it a dependable tool for research involving immune checkpoint regulation, antibody development, and cancer immunotherapy targeting CD276.

CD276, also known as B7-H3, is a member of the B7 family of immune checkpoint proteins that has gained significant attention in cancer immunology due to its multifaceted roles in tumor progression and immune evasion. Originally identified for its costimulatory effects in T cell activation, recent findings illustrate that CD276 primarily exhibits immunosuppressive properties in the tumor microenvironment (TME). High expression levels of CD276 have been associated with several malignancies, including melanoma, pancreatic cancer, and colorectal cancer, where its interaction with immune cells contributes to tumor progression and immune escape mechanisms [1][2][3][4].

The dual role of CD276 as both a costimulatory and a co-inhibitory molecule underscores its complexity. While it can enhance T-cell responses under certain conditions, in the context of cancer, CD276 frequently inhibits T-cell activation and promotes the survival of cancer stem cells. Studies indicate that blocking CD276 can enhance T-cell-mediated antitumor immunity, which is crucial for developing effective immunotherapy strategies [5][3]. For instance, research has demonstrated that the blockade of CD276 enhances CD8+ T cell infiltration and activity against tumors, presenting a therapeutic target for improving immunotherapy outcomes [6][7].

Additionally, CD276's expression is significantly associated with poor clinical outcomes, as its high levels in tumors correlate with reduced infiltration of T cells and other immune effector cells. This correlation has been noted particularly in cancers such as ovarian cancer and pancreatic cancer, where the presence of CD276-expressing tumor cells has been linked to tumor metastasis and resistance to therapies [6][7][4]. Moreover, CD276 facilitates various tumor-promoting processes, including angiogenesis and tumor cell proliferation, thereby augmenting the aggressive phenotype of certain cancers [8][9][10].

References:
[1] G. Li, X. Zhu, & C. Liu. Characterization of immune infiltration and construction of a prediction model for overall survival in melanoma patients. Frontiers in Oncology, vol. 11, 2021. https://doi.org/10.3389/fonc.2021.639059
[2] W. Zhou and W. Jin. B7-h3/cd276: an emerging cancer immunotherapy. Frontiers in Immunology, vol. 12, 2021. https://doi.org/10.3389/fimmu.2021.701006
[3] T. Deng, Y. Deng, et al. Rapidly-manufactured cd276 car-t cells exhibit enhanced persistence and efficacy in pancreatic cancer. Journal of Translational Medicine, vol. 22, no. 1, 2024. https://doi.org/10.1186/s12967-024-05462-7
[4] A. Getu, A. Tigabu, M. Zhou, J. Lu, Ø. Fodstad, & M. Tan. New frontiers in immune checkpoint b7-h3 (cd276) research and drug development. Molecular Cancer, vol. 22, no. 1, 2023. https://doi.org/10.1186/s12943-023-01751-9
[5] X. Liu, Y. Chen, et al. Pan-cancer analysis reveals correlation between rab3b expression and tumor heterogeneity, immune microenvironment, and prognosis in multiple cancers. Scientific Reports, vol. 14, no. 1, 2024. https://doi.org/10.1038/s41598-024-60581-x
[6] X. Liu, P. Liu, et al. Impact of human papillomavirus on the tumor microenvironment in oropharyngeal squamous cell carcinoma. International Journal of Cancer, vol. 150, no. 3, p. 521-531, 2021. https://doi.org/10.1002/ijc.33849
[7] H. Baysal, V. Siozopoulou, et al. The prognostic impact of the immune signature in head and neck squamous cell carcinoma. Frontiers in Immunology, vol. 13, 2022. https://doi.org/10.3389/fimmu.2022.1001161
[8] M. Lv, B. Liu, et al. Engineered biomimetic nanovesicles synergistically remodel folate-nucleotide and γ-aminobutyric acid metabolism to overcome sunitinib-resistant renal cell carcinoma. Acs Nano, vol. 18, no. 40, p. 27487-27502, 2024. https://doi.org/10.1021/acsnano.4c08055
[9] Z. Zhang, J. Xu, Z. Song, J. Zhang, Y. Lin, & J. Ouyang. Bioinformatic analysis and clinical case studies identify cd276 as a promising diagnostic biomarker for clear cell renal cell carcinoma. Cancer Control, vol. 31, 2024. https://doi.org/10.1177/10732748241250181
[10] S. Seaman, Z. Zhu, et al. Eradication of tumors through simultaneous ablation of cd276/b7-h3-positive tumor cells and tumor vasculature. Cancer Cell, vol. 31, no. 4, p. 501-515.e8, 2017. https://doi.org/10.1016/j.ccell.2017.03.005

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*