Recombinant Human Cathepsin B (CTSB), partial (Active)

Unavailable
Code CSB-AP005381HU
MSDS
Size US$195
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Activity
Specific activity as determined by its ability to cleave the fluorogenic peptide substrate Z-LR-AMC is greater than 3000 pmol/min/ug
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
Amyloid precursor protein secretase; APP secretase; APPS; CATB_HUMAN; Cathepsin B heavy chain; Cathepsin B1; CathepsinB; CPSB; CTSB; cysteine protease; OTTHUMP00000116009; OTTHUMP00000229510; OTTHUMP00000229511; OTTHUMP00000229512; OTTHUMP00000229514; OTTHUMP00000229515; OTTHUMP00000229516; Preprocathepsin B
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
18-339aa
Complete Sequence
RSRPSFHPLSDELVNYVNKRNTTWQAGHNFYNVDMSYLKRLCGTFLGGPKPPQRVMFTEDLKLPASFDAREQWPQCPTIKEIRDQGSCGSCWAFGAVEAISDRICIHTNAHVSVEVSAEDLLTCCGSMCGDGCNGGYPAEAWNFWTRKGLVSGGLYESHVGCRPYSIPPCEHHVNGSRPPCTGEGDTPKCSKICEPGYSPTYKQDKHYGYNSYSVSNSEKDIMAEIYKNGPVEGAFSVYSDFLLYKSGVYQHVTGEMMGGHAIRILGWGVENGTPYWLVANSWNTDWGDNGFFKILRGQDHCGIESEVVAGIPRTDQYWEKI
Mol. Weight
36.9 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid
Buffer
0.2 μm filtered 20 mM Tris-HCl, 150 mM NaCl, pH 8.0
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 5-10 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Thiol protease which is believed to participate in intracellular degradation and turnover of proteins. Cleaves matrix extracellular phosphoglycoprotein MEPE. Involved in the solubilization of cross-linked TG/thyroglobulin in the thyroid follicle lumen. Has also been implicated in tumor invasion and metastasis.
Gene References into Functions
  1. Cathepsin B (CTSB) is a novel target gene of hypoxia-inducible factor-1-alpha (HIF-1alpha). CTSB mRNA and protein levels can be up-regulated in a HIF-1alpha-dependent manner. PMID: 29935187
  2. expression of cathepsin B and X was detected in stromal cells and cancer cells throughout the glioblastoma (GBM) sections, whereas cathepsin K expression was more restricted to arteriole-rich regions in the GBM sections. Metabolic mapping showed that cathepsin B, but not cathepsin K is active in GSC niches. PMID: 30046941
  3. we evaluated the involvement of cathepsin B and X in the TGF-b1 signaling pathway, one of the key signaling mechanisms triggering epithelial-mesenchymal transition in cancer. In MCF-7 cells the expression of cathepsin B was shown to depend on their activation with TGF-b1 while, for cathepsin X, a TGF-b1 independent mechanism of induction during EMT is indicated. PMID: 28495172
  4. these data suggest that apoptosis is induced by increasing lysosomal membrane permeability and leakage of CTSB into cytoplasm. PMID: 28478025
  5. These findings indicate that Cathepsin B (CTSB), may be an important prognostic biomarker for late stage colorectal cancer (CRC)and cases with lymph node metastases in the Middle Eastern population. Monitoring serum CTSB in CRC patients may predict and/or diagnose cases with lymph node metastases. PMID: 28440429
  6. Findings from this community-based cohort of young children show that surrogate markers for cardiovascular disease such as total fat mass, percent body fat, abdominal fat, body fat distribution, maximal oxygen uptake and pulse pressure were all associated with cystatin B. This was not found for cathepsin L or cathepsin D PMID: 29149174
  7. Interruption of either CCL2-CCR2 signaling or cathepsin B function significantly impaired perineural invasion (PNI). PMID: 28951461
  8. Data suggest that expression of CTSB in human glioblastoma cell line can be modulated by dietary factors; here, caffeine decreases tumor size and CTSB expression in mouse xenograft model of glioblastoma; note that caffeine, normally a dietary component, was administered via intraperitoneal injection in these studies. PMID: 27260469
  9. SNPs in NLRP3 and CTSB, associated with an increased NLRP3-inflammasome activation, are protective against the development of active pulmonary tuberculosis. PMID: 27101784
  10. cathepsin B activity assays identified secreted cathepsin B as responsible for apoA-I cleavage at Ser(228) Importantly PMID: 27630170
  11. ctsB enhanced neutrophil migration though a putative effect on pseudopod retraction rates. PMID: 28389621
  12. We have shown that keratolytic winter erythema in South African and Norwegian families is caused by two different tandem duplications in a non-coding genomic region upstream of CTSB. PMID: 28457472
  13. CtsB/L as major regulators of lysosomal function and demonstrate that CtsB/L may play an important role in intracellular cholesterol trafficking and in degradation of the key AD proteins PMID: 27902765
  14. in CTSB knockout (KO) mice, running did not enhance adult hippocampal neurogenesis and spatial memory function. Interestingly, in Rhesus monkeys and humans, treadmill exercise elevated CTSB in plasma. PMID: 27345423
  15. Report non-proteolytic cathepsin B functiona in tumor cell lines. PMID: 27526672
  16. cathepsin B (CTSB) inhibition or expression of a CTSB-resistant Dab2 mutant maintains Dab2 expression and shifts long-term TGF-beta-treated cells from autophagy to apoptosis PMID: 27398911
  17. cathepsin L and cathepsin B as the lysosomal cysteine proteases that activate the PEDV spike. PMID: 27729455
  18. Results showed an increase level of CTSL, and CTSB in dilated cardiomyopathy patients which correlates with reduced left ventricular ejection fraction. PMID: 28074340
  19. Gene expression level of genes of CTSB is significantly higher in AD patients when compared to normal controls. PMID: 26943237
  20. Serum CTSB and CTSD concentrations were found to have a diagnostic value in NPC. However, the CTSB and CTSD serum levels had no prognostic role for the outcome in nasopharyngeal carcinoma patients. PMID: 26995190
  21. CTSB might be involved in the development and progression of hepatocellular carcinoma. PMID: 26896959
  22. Cathepsin B knockdown in oral cancer cells reduces cell migration. PMID: 27031837
  23. the authors applied the technique of nanoelectrode arrays to try to detect and compare cathepsin B activities in normal and breast cancer cells. It was found that protease activity correlated positively with the degree of malignancy cancer cells. PMID: 25959927
  24. shedding of surface proteins by extracellular cathepsins impacts intracellular signaling as demonstrated for regulation of Ras GTPase activity. PMID: 26081835
  25. High cathepsin is associated with drug resistance in neuroblastoma. PMID: 25883214
  26. The expressions of cathepsin B strongly correlated with the Mini-Mental State Examination scores of the Alzheimer disease. patients PMID: 25502766
  27. Integrin alphavbeta3 is required for cathepsin B-induced hepatocellular carcinoma progression PMID: 25572981
  28. The serum level of cathepsin L decreased with age, while cathepsin B remained no significant difference between young and aged individuals PMID: 25991043
  29. Cathepsins B and L activity correlates with the efficiency of reovirus-mediated tumor cell killing. PMID: 25633482
  30. enhanced activity and expression of cathepsin B contributes to an increased remodelling of extracellular matrix that favours leiomyoma growth PMID: 25577554
  31. SCD5 impairs SPARC and cathepsin B secretion in human melanoma cells and intracellular pH acidification. PMID: 25802234
  32. data suggest that CTSB is a pathophysiologically relevant protease that activates ENaC in cystic fibrosis airways PMID: 25260629
  33. Cathepsin B activity is increased in blood and CSF from HIV-infected cocaine users. PMID: 25209871
  34. CB was highly upregulated in human ESCC and its precursor lesions. The elevated CB expression in ESCC allowed in vivo and in vitro detection of ESCC xenografts in nude mice. PMID: 24618814
  35. Inactivation of tristetraprolin in chronic hypoxia provokes the expression of cathepsin B PMID: 25452305
  36. A4383C and C76G SNP in Cathepsin B is respectively associated with the high risk and tumor size of hepatocarcinoma. PMID: 25106406
  37. Overexpression of uPAR and cathepsin B increases expression of cytosolic p-JNK. PMID: 24699410
  38. Study shows that CTSB overexpression in the cancer cells increases growth of invasive ductal carcinoma in the MMTV-PyMT mouse model of breast cancer. PMID: 24077280
  39. Cathepsin B (CB) substantially contributes to the invasive phenotype of FLS that leads to joint destruction in RA. PMID: 24749816
  40. Cathepsin D and B activities in the serum of patients with urothelial bladder cancer are directly proportional to disease severity and significantly higher compared with control group. PMID: 25095637
  41. Cathepsin B produces full-length amyloid-beta (Ab(1-40/42)) and pyroglutamate amyloid-beta (pyroGluAb(3-40/42) and is a key drug target for treating Alzheimer's disease by reducing these amyloid-beta species PMID: 24595198
  42. Cathepsin B is a key drug target for reducing the brain damage and improving neuromuscular dysfunction resulting from traumatic brain injury (TBI). PMID: 24083575
  43. Correlation between higher CTSB expression and lower survival rate in human lung squamous cell carcinoma. PMID: 24139065
  44. archazolid reduces the activity of prometastatic proteases like cathepsin B in vitro and in vivo. PMID: 24166050
  45. These observations point to a critical regulatory role for that endogenous CD activity in dopaminergic cells in alpha-synuclein homeostasis which cannot be compensated for by increased Cathepsin B. PMID: 24138030
  46. Data indicate that wild type and mutant amyloid precursor proteins (APP) expression enhances the induction in cathepsin B after administration of proteasome inhibitor MG132. PMID: 24215712
  47. Data suggest that CTSB (cathepsin B) and CTSL (cathepsin L) of the autophagic-lysosomal proteolytic system are involved as the main proteolytic system in skeletal muscle during cancer cachexia development in patients with esophageal cancer. PMID: 24108784
  48. Depletion of Cathepsin B in vitro inhibited cell proliferation. PMID: 23708264
  49. Increased concentrations of cathepsins B, D and G in the proliferative eutopic endometrium may play a role in the implantation of endometrial tissue outside the uterine cavity. PMID: 23466190
  50. High cathepsin expression is associated with dysplasia and colitis-associated cancer. PMID: 23591598

Show More

Hide All

Subcellular Location
Lysosome. Melanosome. Secreted, extracellular space. Apical cell membrane; Peripheral membrane protein; Extracellular side.
Protein Families
Peptidase C1 family
Tissue Specificity
Expressed in the stratum spinosum of the epidermis. Weak expression is detected in the stratum granulosum.
Database Links

HGNC: 2527

OMIM: 116810

KEGG: hsa:1508

STRING: 9606.ENSP00000342070

UniGene: Hs.520898

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*