Code | CSB-MP890933HU |
Size | $468 |
Image | |
Have Questions? | Leave a Message or Start an on-line Chat |
Description |
The product was expressed with the C-terminal 6xHis-tagged human ZNRF3 gene fragment Lys56-Met219 in mammalian cells. Its purity is greater than 95%. Its activity and endotoxin have been determined. ZNRF3 is a transmembrane E3 ubiquitin ligase acting as a negative regulator of the Wnt signaling pathway that targets Wnt receptors for ubiquitination and lysosomal degradation. Together with RNF43, ZNRF3 plays an important role in the development and tissue homeostasis by promoting the turnover of LPR6 and Frizzled (FZD). ZNRF3 and RNF43 are essential for embryonic patterning, sex determination, and limb morphogenesis. ZNRF3 is frequently inactivated in human cancers presenting as deletion or mutation to inhibit Wnt signaling. Loss of ZNRF3/RNF43 activity results in extensive cellular proliferation and metaplasia and has been related to EMT in many Wnt-associated malignancies. |
Purity | Greater than 95% as determined by SDS-PAGE. |
Endotoxin | Less than 1.0 EU/ug as determined by LAL method. |
Activity | Measured by its binding ability in a functional ELISA. Immobilized Human ZNRF3 at 5 μg/mL can bind Human RSPO2 (CSB-MP751021HU1(M)), the EC50 is 5.091-6.991 ng/mL. |
Target Names | ZNRF3 |
Uniprot No. | Q9ULT6 |
Alternative Names | (RING finger protein 203)(RING-type E3 ubiquitin transferase ZNRF3)(Zinc/RING finger protein 3) |
Molecular Characterization | |
Species | Homo sapiens (Human) |
Source | Mammalian cell |
Expression Region | 56-219aa |
Target Protein Sequence | KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM |
Mol. Weight | 20.4 kDa |
Protein Length | Partial |
Tag Info |
C-terminal 6xHis-tagged |
Form |
Lyophilized powder Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand. |
Buffer | Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4 |
Reconstitution | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Troubleshooting and FAQs |
Protein FAQs |
Storage Condition | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Shelf Life | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. |
Lead Time | Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time. |
Notes | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Datasheet & COA | Please contact us to get it. |
There are currently no reviews for this product.
Function |
E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification.
|
Gene References into Functions |
|
Subcellular Location | Cell membrane; Single-pass type I membrane protein. |
Protein Families | ZNRF3 family |
Database Links |
HGNC: 18126 OMIM: 612062 KEGG: hsa:84133 STRING: 9606.ENSP00000443824 UniGene: Hs.604200 |