Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial

In Stock
Code CSB-BP890933HU
Abbreviation Recombinant Human ZNRF3 protein, partial
MSDS
Size $317
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
RING finger protein 203 Zinc/RING finger protein 3
Species
Homo sapiens (Human)
Source
Baculovirus
Expression Region
56-219aa
Target Protein Sequence
KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
23.8 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human E3 ubiquitin-protein ligase ZNRF3 is produced through the baculovirus expression system and contains amino acids 56 to 219 of the protein. A C-terminal 6xHis-tag is attached to this partial protein, which makes purification and detection more straightforward. The product achieves purity levels above 90%, confirmed by SDS-PAGE analysis. This appears to provide high-quality material for research focused on understanding ubiquitin-mediated processes.

ZNRF3 functions as an E3 ubiquitin-protein ligase that's involved in regulating Wnt signaling pathways. The protein promotes ubiquitination and subsequent degradation of Frizzled receptors. This activity seems critical for modulating cellular signaling and maintaining tissue homeostasis. Studying this protein may be important for understanding how cells communicate and how signaling pathways contribute to various physiological processes.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

Human ZNRF3 is a large transmembrane E3 ubiquitin ligase whose catalytic activity depends on its C-terminal RING domain, which is responsible for ubiquitin transfer. The 56-219aa fragment represents the extracellular portion of the full-length protein and almost certainly does not contain the critical RING domain. Therefore, this fragment itself lacks E3 ubiquitin ligase activity. While the baculovirus expression system may support proper folding of this extracellular domain fragment, its biological function remains unknown, and it is incapable of catalytic activity.

1. Antibody Development and Validation

This application is highly suitable as antibody development relies on antigenic sequence recognition rather than functional activity. The fragment can generate antibodies specific to the 56-219aa region of ZNRF3's extracellular domain.

2. Biochemical Characterization and Stability Studies

These studies can characterize physical properties but cannot assess E3 ligase activity. Thermal stability, solubility, and oligomerization state can be analyzed, but results will only reflect this fragment's behavior, not the full protein's functionality.

3. ELISA-Based Quantitative Assays

This application is well-suited as it depends on immunoreactivity rather than catalytic function. The fragment can serve as an antigen for detection assays targeting the extracellular domain.

Final Recommendation & Action Plan

This ZNRF3 fragment (56-219aa) is a partial, functionally undefined protein portion that lacks the critical RING domain required for E3 ubiquitin ligase activity. It is suitable for Applications 1 and 3 (antibody development and ELISA), which rely on immunoreactivity rather than function. Application 2 can proceed, but only for basic biophysical characterization of this specific fragment. While the extracellular domain may mediate some interactions, without the full protein context and known functional domains, any interaction data would be difficult to interpret biologically. There is a high risk of identifying non-specific or biologically irrelevant binding partners. Researchers should be aware that this fragment represents only a small portion of ZNRF3, and results cannot be extrapolated to understand the full protein's biological functions. For ZNRF3 functional studies, a full-length protein containing the RING domain is essential.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification.
Gene References into Functions
  1. The present study suggests rs7290117 in ZNRF3 may be involved in the regulation of axial length, though our results do not support a contribution of the SNPs we tested in ZNRF3, HGF and MFRP to primary angle-closure glaucoma in northern Chinese people PMID: 30348125
  2. Missense variants of ZNRF3 are associated with Disorders of Sex Development. PMID: 29735715
  3. ZNRF3 inhibited the metastasis and tumorigenesis via suppressing the Wnt/beta-catenin signaling pathway in NPC cells. PMID: 27733215
  4. Data indicate that clinical specimens showed a significant inverse correlation between zinc and ring finger 3 (ZNRF3) and beta-catenin mRNA levels. PMID: 27448298
  5. miR-93/ZNRF3/Wnt/beta-catenin regulatory network contributes to the growth of lung carcinoma. PMID: 26423400
  6. ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways, and probably this way it negatively regulates cancer progression. PMID: 27352324
  7. ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways and probably this way it negatively regulates cancer progression PMID: 25923840
  8. Report shows that miR-146b participated in migration, invasion and chemoresistance in osteosarcoma via downregulation of ZNRF3. PMID: 26549292
  9. ZNRF3 binds RSPO1 and LGR5-RSPO1 with micromolar affinity via RSPO1 furin-like 1 (Fu1) domain. PMID: 24349440
  10. Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14 PMID: 23670221
  11. ZNRF3 inhibits gastric cancer cell growth and promotes cell apoptosis by affecting the Wnt/beta-catenin/TCF4 signalling pathway. PMID: 23504200
  12. study provides new mechanistic insights into the regulation of Wnt receptor turnover, and reveals ZNRF3 as a tractable target for therapeutic exploration PMID: 22575959

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
ZNRF3 family
Database Links

HGNC: 18126

OMIM: 612062

KEGG: hsa:84133

STRING: 9606.ENSP00000443824

UniGene: Hs.604200

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*