Purity
Greater than 90% as determined by SDS-PAGE.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
ZNRF3; KIAA1133; RNF203; E3 ubiquitin-protein ligase ZNRF3; EC 2.3.2.27; RING finger protein 203; RING-type E3 ubiquitin transferase ZNRF3; Zinc/RING finger protein 3
Species
Homo sapiens (Human)
Expression Region
56-219aa
Target Protein Sequence
KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Protein Length
Extracellular Domain
Tag Info
N-terminal 6xHis-SUMO-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the
glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer,
6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The synthesis of this Recombinant Human ZNRF3 protein depends on the utilization of recombinant DNA technology. DNA sequences that encoded the ZNRF3 protein could be inserted into a vector and introduced into an expression host, E.coli, where it could be easily expressed in and purified from. The expression of this ZNRF3 protein was at 56-219aa. N-terminal 6xHis-SUMO tag was fused with this protein. The purity is 90%+ determined by SDS-PAGE.
ZNRF3 (also known as KIAA1133 or RNF203) is gene encoding a protein named E3 ubiquitin-protein ligase ZNRF3 (ZNRF3) in human. The protein encoded by this gene is also known as RING finger protein 203, RING-type E3 ubiquitin transferase ZNRF3 or Zinc/RING finger protein 3. Emerging evidence has implied that ZNRF3 is associated with the Wnt receptor complex, and inhibits Wnt signalling by promoting the turnover of frizzled and LRP6. The protein encoded by ZNRF3 gene is an enzyme that has ubiquitin protein ligase and ubiquitin-protein transferase activity. It is involved many biological processes, including limb development, negative regulation of Wnt signaling pathway, stem cell proliferation and protein ubiquitination.