Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

ZNRF3

Uniprot No.

Q9ULT6

Research Area

Epigenetics and Nuclear Signaling

Alternative Names

ZNRF3; KIAA1133; RNF203; E3 ubiquitin-protein ligase ZNRF3; EC 2.3.2.27; RING finger protein 203; RING-type E3 ubiquitin transferase ZNRF3; Zinc/RING finger protein 3

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

56-219aa

Target Protein Sequence

KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

34.2kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-SUMO-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The synthesis of this Recombinant Human ZNRF3 protein depends on the utilization of recombinant DNA technology. DNA sequences that encoded the ZNRF3 protein could be inserted into a vector and introduced into an expression host, E.coli, where it could be easily expressed in and purified from. The expression of this ZNRF3 protein was at 56-219aa. N-terminal 6xHis-SUMO tag was fused with this protein. The purity is 90%+ determined by SDS-PAGE.

ZNRF3 (also known as KIAA1133 or RNF203) is gene encoding a protein named E3 ubiquitin-protein ligase ZNRF3 (ZNRF3) in human. The protein encoded by this gene is also known as RING finger protein 203, RING-type E3 ubiquitin transferase ZNRF3 or Zinc/RING finger protein 3. Emerging evidence has implied that ZNRF3 is associated with the Wnt receptor complex, and inhibits Wnt signalling by promoting the turnover of frizzled and LRP6. The protein encoded by ZNRF3 gene is an enzyme that has ubiquitin protein ligase and ubiquitin-protein transferase activity. It is involved many biological processes, including limb development, negative regulation of Wnt signaling pathway, stem cell proliferation and protein ubiquitination.

Target Background

Function

E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification.

Gene References into Functions

The present study suggests rs7290117 in ZNRF3 may be involved in the regulation of axial length, though our results do not support a contribution of the SNPs we tested in ZNRF3, HGF and MFRP to primary angle-closure glaucoma in northern Chinese people PMID: 30348125
Missense variants of ZNRF3 are associated with Disorders of Sex Development. PMID: 29735715
ZNRF3 inhibited the metastasis and tumorigenesis via suppressing the Wnt/beta-catenin signaling pathway in NPC cells. PMID: 27733215
Data indicate that clinical specimens showed a significant inverse correlation between zinc and ring finger 3 (ZNRF3) and beta-catenin mRNA levels. PMID: 27448298
miR-93/ZNRF3/Wnt/beta-catenin regulatory network contributes to the growth of lung carcinoma. PMID: 26423400
ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways, and probably this way it negatively regulates cancer progression. PMID: 27352324
ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways and probably this way it negatively regulates cancer progression PMID: 25923840
Report shows that miR-146b participated in migration, invasion and chemoresistance in osteosarcoma via downregulation of ZNRF3. PMID: 26549292
ZNRF3 binds RSPO1 and LGR5-RSPO1 with micromolar affinity via RSPO1 furin-like 1 (Fu1) domain. PMID: 24349440
Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14 PMID: 23670221
ZNRF3 inhibits gastric cancer cell growth and promotes cell apoptosis by affecting the Wnt/beta-catenin/TCF4 signalling pathway. PMID: 23504200
study provides new mechanistic insights into the regulation of Wnt receptor turnover, and reveals ZNRF3 as a tractable target for therapeutic exploration PMID: 22575959

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

ZNRF3 family

Database Links

HGNC: 18126

OMIM: 612062

KEGG: hsa:84133

STRING: 9606.ENSP00000443824

UniGene: Hs.604200

Code	CSB-EP890933HU
Abbreviation	Recombinant Human ZNRF3 protein, partial
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage