Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3), partial

In Stock
Code CSB-YP890933HU
Abbreviation Recombinant Human ZNRF3 protein, partial
MSDS
Size $250
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Epigenetics and Nuclear Signaling
Alternative Names
(RING finger protein 203)(RING-type E3 ubiquitin transferase ZNRF3)(Zinc/RING finger protein 3)
Species
Homo sapiens (Human)
Source
Yeast
Expression Region
56-219aa
Target Protein Sequence
KETAFVEVVLFESSPSGDYTTYTTGLTGRFSRAGATLSAEGEIVQMHPLGLCNNNDEEDLYEYGWVGVVKLEQPELDPKPCLTVLGKAKRAVQRGATAVIFDVSENPEAIDQLNQGSEDPLKRPVVYVKGADAIKLMNIVNKQKVARARIQHRPPRQPTEYFDM
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
19.7 kDa
Protein Length
Partial
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Human E3 ubiquitin-protein ligase ZNRF3 (ZNRF3) comes from a yeast expression system and contains a partial protein length spanning amino acids 56 to 219. The product includes a C-terminal 6xHis-tag, which makes purification and detection more straightforward. SDS-PAGE analysis confirms the protein achieves greater than 90% purity, suggesting it should deliver reliable results in research applications.

ZNRF3 belongs to the E3 ubiquitin ligase family and appears to play a critical role in regulating the Wnt signaling pathway. Through this pathway modulation, ZNRF3 likely influences cellular proliferation, differentiation, and apoptosis. Its function seems vital for maintaining cellular homeostasis, which is why it has become a significant focus in various research areas—particularly those investigating cell signaling and cancer biology.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

1. Protein-Protein Interaction Studies

This recombinant ZNRF3 fragment (56-219aa) with its C-terminal His-tag works well in pull-down assays designed to identify and characterize binding partners of the ZNRF3 protein. The His-tag allows for immobilization on nickel-affinity resins, enabling researchers to capture interacting proteins from cell lysates or purified protein libraries. Given that ZNRF3 is an E3 ubiquitin ligase, this fragment may still retain domains involved in substrate recognition or regulatory protein interactions. Studies like these could help clarify the molecular mechanisms that drive ZNRF3 function in cellular signaling pathways.

2. Antibody Development and Validation

The purified recombinant ZNRF3 protein fragment serves as an immunogen for generating specific antibodies against human ZNRF3. The >90% purity determined by SDS-PAGE appears suitable for immunization protocols in antibody production. This protein can also function as a positive control and standard for validating the specificity and sensitivity of newly developed anti-ZNRF3 antibodies across various immunoassays. The defined amino acid region (56-219aa) offers a well-characterized epitope source for antibody screening applications.

3. Structural and Biochemical Characterization

This ZNRF3 protein fragment can be applied in biophysical studies to investigate the structural properties of the 56-219aa region of human ZNRF3. Its high purity level makes it appropriate for techniques like circular dichroism spectroscopy, dynamic light scattering, or analytical ultracentrifugation to assess protein folding and stability. The yeast expression system may yield properly folded protein that's suitable for preliminary structural studies. Such characterization could reveal insights into the domain organization and stability of this particular region of the E3 ubiquitin ligase.

4. ELISA-Based Quantitative Assays

The His-tagged ZNRF3 fragment can function as a capture antigen or standard in enzyme-linked immunosorbent assays (ELISA) for research applications. The C-terminal His-tag allows for oriented immobilization on nickel-coated plates, potentially improving assay reproducibility and sensitivity. This protein could serve as a reference standard for developing quantitative assays that measure ZNRF3 levels in cell culture samples or tissue extracts. The defined concentration and purity of this recombinant protein makes it possible to establish standard curves for quantitative measurements.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
E3 ubiquitin-protein ligase that acts as a negative regulator of the Wnt signaling pathway by mediating the ubiquitination and subsequent degradation of Wnt receptor complex components Frizzled and LRP6. Acts on both canonical and non-canonical Wnt signaling pathway. Acts as a tumor suppressor in the intestinal stem cell zone by inhibiting the Wnt signaling pathway, thereby resticting the size of the intestinal stem cell zone. Along with RSPO2 and RNF43, constitutes a master switch that governs limb specification.
Gene References into Functions
  1. The present study suggests rs7290117 in ZNRF3 may be involved in the regulation of axial length, though our results do not support a contribution of the SNPs we tested in ZNRF3, HGF and MFRP to primary angle-closure glaucoma in northern Chinese people PMID: 30348125
  2. Missense variants of ZNRF3 are associated with Disorders of Sex Development. PMID: 29735715
  3. ZNRF3 inhibited the metastasis and tumorigenesis via suppressing the Wnt/beta-catenin signaling pathway in NPC cells. PMID: 27733215
  4. Data indicate that clinical specimens showed a significant inverse correlation between zinc and ring finger 3 (ZNRF3) and beta-catenin mRNA levels. PMID: 27448298
  5. miR-93/ZNRF3/Wnt/beta-catenin regulatory network contributes to the growth of lung carcinoma. PMID: 26423400
  6. ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways, and probably this way it negatively regulates cancer progression. PMID: 27352324
  7. ZnRF3 negatively influences both the Wnt and Hedgehog proliferative pathways and probably this way it negatively regulates cancer progression PMID: 25923840
  8. Report shows that miR-146b participated in migration, invasion and chemoresistance in osteosarcoma via downregulation of ZNRF3. PMID: 26549292
  9. ZNRF3 binds RSPO1 and LGR5-RSPO1 with micromolar affinity via RSPO1 furin-like 1 (Fu1) domain. PMID: 24349440
  10. Genes within recently identified loci associated with waist-hip ratio (WHR) exhibit fat depot-specific mRNA expression, which correlates with obesity-related traits. Adipose tissue (AT) mRNA expression of 6 genes (TBX15/WARS2, STAB1, PIGC, ZNRF3, GRB14 PMID: 23670221
  11. ZNRF3 inhibits gastric cancer cell growth and promotes cell apoptosis by affecting the Wnt/beta-catenin/TCF4 signalling pathway. PMID: 23504200
  12. study provides new mechanistic insights into the regulation of Wnt receptor turnover, and reveals ZNRF3 as a tractable target for therapeutic exploration PMID: 22575959

Show More

Hide All

Subcellular Location
Cell membrane; Single-pass type I membrane protein.
Protein Families
ZNRF3 family
Database Links

HGNC: 18126

OMIM: 612062

KEGG: hsa:84133

STRING: 9606.ENSP00000443824

UniGene: Hs.604200

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*