Product Details

Purity

≥ 95% as determined by SDS-PAGE.
≥ 95% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

①Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/mL can bind Anti-GPC3 recombinant antibody (CSB-RA009705A1HU). The EC50 is 0.2007-0.2567 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/mL can bind Anti-GPC3 recombinant antibody (CSB-RA009705MA2HU). The EC50 is 0.3261-0.3657 ng/mL.

Target Names

GPC3

Uniprot No.

P51654

Alternative Names

Glypican-3; GTR2-2; Intestinal protein OCI-5; MXR7 [Cleaved into: Glypican-3 alpha subunit; Glypican-3 beta subunit]

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

524-563aa

Target Protein Sequence

AELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLK

Mol. Weight

32.1 kDa

Protein Length

Partial

Tag Info

N-terminal mFc-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Glypican-3 serves as a diagnostic and therapeutic target in hepatocellular carcinoma and other malignancies, yet reliable reagents for antibody validation remain scarce. This mammalian-expressed fragment spanning residues 524–563 demonstrates robust antibody-binding capacity in functional ELISA, with EC50 values of 0.20–0.26 ng/mL and 0.33–0.37 ng/mL against two distinct anti-GPC3 recombinant antibodies, confirming epitope accessibility and structural fidelity. The quantitative binding data supports its use as a coating antigen for antibody validation assays, enabling researchers to assess specificity and affinity of GPC3-targeting therapeutics or diagnostics. Purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg align with standards expected in cancer invasion models and receptor interaction studies where low background interference is critical.

Target Background

Function

Cell surface proteoglycan that bears heparan sulfate. Negatively regulates the hedgehog signaling pathway when attached via the GPI-anchor to the cell surface by competing with the hedgehog receptor PTC1 for binding to hedgehog proteins. Binding to the hedgehog protein SHH triggers internalization of the complex by endocytosis and its subsequent lysosomal degradation. Positively regulates the canonical Wnt signaling pathway by binding to the Wnt receptor Frizzled and stimulating the binding of the Frizzled receptor to Wnt ligands. Positively regulates the non-canonical Wnt signaling pathway. Binds to CD81 which decreases the availability of free CD81 for binding to the transcriptional repressor HHEX, resulting in nuclear translocation of HHEX and transcriptional repression. Inhibits the dipeptidyl peptidase activity of DPP4. Plays a role in limb patterning and skeletal development by controlling the cellular response to BMP4. Modulates the effects of growth factors BMP2, BMP7 and FGF7 on renal branching morphogenesis. Required for coronary vascular development. Plays a role in regulating cell movements during gastrulation.

Gene References into Functions

The areas under the receiver operating curve (AUROC) value, sensitivity and specificity of glypican 3 (GPC3) for hepatoblastoma (HB) pretreatment group versus all controls were all significantly lower than those of alpha-fetoprotein (AFP). PMID: 28378832
GPC3 is operating through an intricate molecular signaling network. From the balance of these interactions, the inhibition of breast metastatic spread induced by GPC3 emerges. PMID: 30267212
Its surface is modified with anti-GPC3 antibody. PMID: 29916268
data suggest that transcriptionally targeted delivery of transgene in HCC cells can be achieved using the GPC3 promoter and this targeting strategy produces limited toxicity to normal liver cells PMID: 29563582
High GPC3 expression is associated with Hepatocellular Carcinoma. PMID: 28429175
Study demonstrated that GPC3 expression is inversely associated with glucose metabolism, suggesting that GPC3 may play a role in regulating glucose metabolism in hepatocellular carcinoma. PMID: 29398870
the intravenous injection of SF-PL/siGPC3 into nude mice bearing subcutaneous human HepG2 xenografts effectively inhibited tumor growth and also increased the survival rates of animals. These results revealed the great potential of the PEI-modified liposomal nanomedicine carrying SF and siGPC3 to improve Hepatocellular carcinomatreatment PMID: 29106433
Invasive hepatocellular carcinoma (HCC) samples and HCC cell lines with high metastatic potential exhibited higher MXR7 expression. Overexpression of MXR7 promoted epithelial-mesenchymal transition (EMT) progress, and MXR7 depletion repressed the EMT phenotype. Human MXR7 protein is a mediator of EMT and metastasis in HCC. PMID: 28812296
Overexpression of GPC3 was significantly associated with poor prognosis in patients with hepatocellular carcinoma. PMID: 29901640
These data show that glycanation and convertase maturation are not required for soluble mutant GPC3 to inhibit hepatocellular carcinoma cell proliferation. PMID: 29345911
Data indicate that several microRNAs targeting the oncogenic functions of glypican-3 (GPC3). PMID: 28476031
presence distinguishes aggressive from non-aggressive odontogenic tumors PMID: 27647326
GPC3 as a potential metastasis suppressor gene and suggest its value as a prognostic marker in gastric cancer. PMID: 27259271
In this study we systematically evaluated a series of CAR constructs targeting glypican-3 (GPC3), which is selectively expressed on several solid tumors. We compared GPC3-specific CARs that encoded CD3zeta (Gz) alone or with costimulatory domains derived from CD28 (G28z), 4-1BB (GBBz), or CD28 and 4-1BB (G28BBz). PMID: 27530312
Data indicate that glypican-3 (GPC3) is an important regulator of epithelial-mesenchymal transition (EMT) in breast cancer, and a potential target for procedures against breast cancer metastasis. PMID: 27507057
Glypican-3 overexpression in Wilms tumor correlates with poor overall survival. PMID: 28432433
glypican-3 has a role in HBV-related hepatocellular carcinoma PMID: 27286460
MOSPD1 is a possible candidate gene for DORV, probably in combination with GPC3. Further studies of the combined functions of MOSPD1 and GPC3 are needed, and identification of additional patients with MOSPD1 and GPC3 duplication should be pursued PMID: 28636109
Glypican-3 is correlated with the clinical malignant behavior of hepatocellular carcinoma and its phenotype changes from positive to negative during tumor cells differentia- tion. PMID: 28087980
The diagnostic sensitivity for hepatocellular carcinoma increased to 72.8% (206 of the 283) when glypican 3 was combined with alpha-fetoprotein. PMID: 26370140
The lncRNA glypican 3 antisense transcript 1 (GPC3-AS1) has been reported to be a potential biomarker for hepatocellular carcinoma (HCC) screening. We observed a significant upregulation of GPC3-AS1 in HCC. Increased expression of GPC3-AS1 was associated with alpha-fetoprotein, tumor size, microvascular invasion, encapsulation, Barcelona Clinic Liver Cancer stage, and worse prognosis of HCC patients. PMID: 27573079
study provides the first evidence that GPC3 can modulate the PCSK9 extracellular activity as a competitive binding partner to the LDLR in HepG2 cells. PMID: 27758865
By subsequent Sanger sequencing of genomic DNA we could map the chromosomal break points to define a deletion size of 43,617 bp including exons 5 and 6 of the GPC3 gene. PMID: 28371070
This is the first study in which the optimal HLA-A*0201 GPC3 epitopes were screened from a large number of candidates predicted by three software. The optimized HLA-A*0201 GPC3 peptides will provide new epitope candidates for hepatocellular carcinoma (HCC) immunotherapy. PMID: 27102087
GPC3 and KRT19 overexpression are associated with carcinogenesis, progression, and poor prognosis in patients with PDAC and a valuable biomarker for diagnosis of PDAC. PMID: 27689616
The clinical implication of GPC3 detection and targeting in the management of patients with hepatocellular carcinoma. Review. PMID: 26755876
Glypican 3 expression showed a significant difference between endometrioid endometrial carcinoma and serous endometrial carcinoma, and it was significantly correlated with tumor grade, stage and myometrial invasion PMID: 26722522
Data show that notum and glypican-1 and glypican-3 gene expression during colorectal cancer (CRC) development and present evidence to suggest them as potential new biomarkers of CRC pathogenesis. PMID: 26517809
GPC3 expression was measured in hepatocellular carcinoma at different stages and correlated with prognosis. CK19+/GPC3+ HCC has the highest risk of intrahepatic metastasis, microvascular invasion, regional lymph node involvement, and distant metastasis. PMID: 26977595
Review: Glypican-3 is a highly specific biomarker for the diagnosis of hepatocellular carcinoma and a promising therapeutic target. PMID: 26256079
In South Korean hepatocellular carcinoma patients, GPC3 expression was more frequent in hepatocellular carcinoma with aggressive features, but it was not an independent prognostic biomarker. PMID: 26764243
In this meta-analysis, GPC3 was found to be acceptable as a serum marker for the diagnosis of hepatocellular carcinoma. PMID: 26502856
GPC3 may be a candidate marker for detecting lung squamous cell carcinoma. PMID: 26345955
study suggests that GPC3 is involved in HCC cell migration and motility through HS chain-mediated cooperation with the HGF/Met pathway, showing how HS targeting has potential therapeutic implications for liver cancer PMID: 26332121
potential role of GPC3 in urothelial carcinogenesis warrants further investigation, especially the potential use of Glypican-3 for therapeutic and diagnostic purposes PMID: 25896897
Downregulation of glypican-3 expression increases migration, invasion, and tumorigenicity of ovarian cancer. PMID: 25967456
GPC3 expression is an independent prognostic factor for postoperative hepatocellular carcinoma PMID: 25432695
Identify a GPC3-specific T-cell receptor. Expression of this receptor by T cells allows them to recognize and kill GPC3-positive hepatoma cells. PMID: 26052074
High expression of glypican-3 is associated hepatoblastoma. PMID: 25735325
GPC3 and E-cadherin expressions are not independent prognostic factors in CRC. PMID: 25619476
In HCC patients, sGPC3N levels were significantly increased (mean/median, 405.16/236.19 pg mL(-1) ) compared to healthy controls (p < 0.0001), and 60% of HCC cases (69/115) showed sGPC3N levels that were higher than the upper normal limit. PMID: 25784484
GPC3 contributes to hepatocellular carcinoma progression and metastasis through impacting epithelial-mesenchymal transition of cancer cells, and the effects of GPC3 are associated with ERK activation. PMID: 25572615
Most cases of hepatoblastoma and yolk sac tumor, and some cases of other tumors were found to express GPC3. On the other hand, GPC3 was physiologically expressed during the fetal and neoinfantile period under 1 year of age. PMID: 25344940
OPN, SPINK1, GPC3 and KNPA2 were significantly over-expressed in HCC tissues. These genes may be useful in developing future biomarkers and therapeutic strategies for HCC PMID: 25862856
Data indicate that zinc-fingers and homeoboxes 2 (ZHX2) suppresses glypican 3 (GPC3) transcription by binding with its core promoter. PMID: 25195714
propose that the structural changes generated by the lack of cleavage determine a change in the sulfation of the HS chains and that these hypersulfated chains mediate the interaction of the mutant GPC3 with Ptc PMID: 25653284
GPC3 is associated with the HCC cell biological behavior. PMID: 25270552
Data indicate that the triple stain of reticulin, glypican-3, and glutamine synthetae is useful in the differentiation of hepatocellular carcinoma, hepatic adenoma, and focal nodular hyperplasia. PMID: 25822763
Data shows that GPC3 gene expression is downregulated in primary clear cell renal cell carcinoma; its overexpression arrest cells in G1 phase suggesting its role as tumor suppressor in clear cell renal cell carcinoma. PMID: 25168166
This study demonstrated that highly expression of GPC3 could enrich hepatocellular carcinoma -related genes' mRNA expression and positive associate with dysplasia in cirrhotic livers. PMID: 25542894

Hide All

Involvement in disease

Simpson-Golabi-Behmel syndrome 1 (SGBS1)

Subcellular Location

Cell membrane; Lipid-anchor, GPI-anchor; Extracellular side.

Protein Families

Glypican family

Tissue Specificity

Highly expressed in lung, liver and kidney.

Database Links

HGNC: 4451

OMIM: 300037

KEGG: hsa:2719

STRING: 9606.ENSP00000377836

UniGene: Hs.644108

Code	CSB-MP009705HU1
Abbreviation	Recombinant Human GPC3 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$9.9
Promotion
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/ml can bind Anti-GPC3 recombinant antibody (CSB-RA009705A1HU). The EC₅₀ is 0.2007-0.2567 ng/mL. Biological Activity Assay Activity Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/ml can bind Anti-GPC3 recombinant antibody (CSB-RA009705MA2HU). The EC₅₀ is 0.3261-0.3657 ng/mL. Biological Activity Assay The purity of GPC3 was greater than 95% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Glypican-3 (GPC3), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage