Recombinant Human Glypican-3 (GPC3), partial (Active)

In Stock
Code CSB-MP009705HU1
Abbreviation Recombinant Human GPC3 protein, partial (Active)
MSDS
Size $138
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/ml can bind Anti-GPC3 recombinant antibody (CSB-RA009705A1HU). The EC50 is 0.2007-0.2567 ng/mL.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/ml can bind Anti-GPC3 recombinant antibody (CSB-RA009705MA2HU). The EC50 is 0.3261-0.3657 ng/mL.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
①Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/mL can bind Anti-GPC3 recombinant antibody (CSB-RA009705A1HU). The EC50 is 0.2007-0.2567 ng/mL. ②Measured by its binding ability in a functional ELISA. Immobilized Human GPC3 at 2 μg/mL can bind Anti-GPC3 recombinant antibody (CSB-RA009705MA2HU). The EC50 is 0.3261-0.3657 ng/mL.
Target Names
Uniprot No.
Alternative Names
Glypican-3; GTR2-2; Intestinal protein OCI-5; MXR7 [Cleaved into: Glypican-3 alpha subunit; Glypican-3 beta subunit]
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
524-563aa
Target Protein Sequence
AELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLK
Mol. Weight
32.1 kDa
Protein Length
Partial
Tag Info
N-terminal mFc-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Cell surface proteoglycan that bears heparan sulfate. Negatively regulates the hedgehog signaling pathway when attached via the GPI-anchor to the cell surface by competing with the hedgehog receptor PTC1 for binding to hedgehog proteins. Binding to the hedgehog protein SHH triggers internalization of the complex by endocytosis and its subsequent lysosomal degradation. Positively regulates the canonical Wnt signaling pathway by binding to the Wnt receptor Frizzled and stimulating the binding of the Frizzled receptor to Wnt ligands. Positively regulates the non-canonical Wnt signaling pathway. Binds to CD81 which decreases the availability of free CD81 for binding to the transcriptional repressor HHEX, resulting in nuclear translocation of HHEX and transcriptional repression. Inhibits the dipeptidyl peptidase activity of DPP4. Plays a role in limb patterning and skeletal development by controlling the cellular response to BMP4. Modulates the effects of growth factors BMP2, BMP7 and FGF7 on renal branching morphogenesis. Required for coronary vascular development. Plays a role in regulating cell movements during gastrulation.
Gene References into Functions
  1. The areas under the receiver operating curve (AUROC) value, sensitivity and specificity of glypican 3 (GPC3) for hepatoblastoma (HB) pretreatment group versus all controls were all significantly lower than those of alpha-fetoprotein (AFP). PMID: 28378832
  2. GPC3 is operating through an intricate molecular signaling network. From the balance of these interactions, the inhibition of breast metastatic spread induced by GPC3 emerges. PMID: 30267212
  3. Its surface is modified with anti-GPC3 antibody. PMID: 29916268
  4. data suggest that transcriptionally targeted delivery of transgene in HCC cells can be achieved using the GPC3 promoter and this targeting strategy produces limited toxicity to normal liver cells PMID: 29563582
  5. High GPC3 expression is associated with Hepatocellular Carcinoma. PMID: 28429175
  6. Study demonstrated that GPC3 expression is inversely associated with glucose metabolism, suggesting that GPC3 may play a role in regulating glucose metabolism in hepatocellular carcinoma. PMID: 29398870
  7. the intravenous injection of SF-PL/siGPC3 into nude mice bearing subcutaneous human HepG2 xenografts effectively inhibited tumor growth and also increased the survival rates of animals. These results revealed the great potential of the PEI-modified liposomal nanomedicine carrying SF and siGPC3 to improve Hepatocellular carcinomatreatment PMID: 29106433
  8. Invasive hepatocellular carcinoma (HCC) samples and HCC cell lines with high metastatic potential exhibited higher MXR7 expression. Overexpression of MXR7 promoted epithelial-mesenchymal transition (EMT) progress, and MXR7 depletion repressed the EMT phenotype. Human MXR7 protein is a mediator of EMT and metastasis in HCC. PMID: 28812296
  9. Overexpression of GPC3 was significantly associated with poor prognosis in patients with hepatocellular carcinoma. PMID: 29901640
  10. These data show that glycanation and convertase maturation are not required for soluble mutant GPC3 to inhibit hepatocellular carcinoma cell proliferation. PMID: 29345911
  11. Data indicate that several microRNAs targeting the oncogenic functions of glypican-3 (GPC3). PMID: 28476031
  12. presence distinguishes aggressive from non-aggressive odontogenic tumors PMID: 27647326
  13. GPC3 as a potential metastasis suppressor gene and suggest its value as a prognostic marker in gastric cancer. PMID: 27259271
  14. In this study we systematically evaluated a series of CAR constructs targeting glypican-3 (GPC3), which is selectively expressed on several solid tumors. We compared GPC3-specific CARs that encoded CD3zeta (Gz) alone or with costimulatory domains derived from CD28 (G28z), 4-1BB (GBBz), or CD28 and 4-1BB (G28BBz). PMID: 27530312
  15. Data indicate that glypican-3 (GPC3) is an important regulator of epithelial-mesenchymal transition (EMT) in breast cancer, and a potential target for procedures against breast cancer metastasis. PMID: 27507057
  16. Glypican-3 overexpression in Wilms tumor correlates with poor overall survival. PMID: 28432433
  17. glypican-3 has a role in HBV-related hepatocellular carcinoma PMID: 27286460
  18. MOSPD1 is a possible candidate gene for DORV, probably in combination with GPC3. Further studies of the combined functions of MOSPD1 and GPC3 are needed, and identification of additional patients with MOSPD1 and GPC3 duplication should be pursued PMID: 28636109
  19. Glypican-3 is correlated with the clinical malignant behavior of hepatocellular carcinoma and its phenotype changes from positive to negative during tumor cells differentia- tion. PMID: 28087980
  20. The diagnostic sensitivity for hepatocellular carcinoma increased to 72.8% (206 of the 283) when glypican 3 was combined with alpha-fetoprotein. PMID: 26370140
  21. The lncRNA glypican 3 antisense transcript 1 (GPC3-AS1) has been reported to be a potential biomarker for hepatocellular carcinoma (HCC) screening. We observed a significant upregulation of GPC3-AS1 in HCC. Increased expression of GPC3-AS1 was associated with alpha-fetoprotein, tumor size, microvascular invasion, encapsulation, Barcelona Clinic Liver Cancer stage, and worse prognosis of HCC patients. PMID: 27573079
  22. study provides the first evidence that GPC3 can modulate the PCSK9 extracellular activity as a competitive binding partner to the LDLR in HepG2 cells. PMID: 27758865
  23. By subsequent Sanger sequencing of genomic DNA we could map the chromosomal break points to define a deletion size of 43,617 bp including exons 5 and 6 of the GPC3 gene. PMID: 28371070
  24. This is the first study in which the optimal HLA-A*0201 GPC3 epitopes were screened from a large number of candidates predicted by three software. The optimized HLA-A*0201 GPC3 peptides will provide new epitope candidates for hepatocellular carcinoma (HCC) immunotherapy. PMID: 27102087
  25. GPC3 and KRT19 overexpression are associated with carcinogenesis, progression, and poor prognosis in patients with PDAC and a valuable biomarker for diagnosis of PDAC. PMID: 27689616
  26. The clinical implication of GPC3 detection and targeting in the management of patients with hepatocellular carcinoma. Review. PMID: 26755876
  27. Glypican 3 expression showed a significant difference between endometrioid endometrial carcinoma and serous endometrial carcinoma, and it was significantly correlated with tumor grade, stage and myometrial invasion PMID: 26722522
  28. Data show that notum and glypican-1 and glypican-3 gene expression during colorectal cancer (CRC) development and present evidence to suggest them as potential new biomarkers of CRC pathogenesis. PMID: 26517809
  29. GPC3 expression was measured in hepatocellular carcinoma at different stages and correlated with prognosis. CK19+/GPC3+ HCC has the highest risk of intrahepatic metastasis, microvascular invasion, regional lymph node involvement, and distant metastasis. PMID: 26977595
  30. Review: Glypican-3 is a highly specific biomarker for the diagnosis of hepatocellular carcinoma and a promising therapeutic target. PMID: 26256079
  31. In South Korean hepatocellular carcinoma patients, GPC3 expression was more frequent in hepatocellular carcinoma with aggressive features, but it was not an independent prognostic biomarker. PMID: 26764243
  32. In this meta-analysis, GPC3 was found to be acceptable as a serum marker for the diagnosis of hepatocellular carcinoma. PMID: 26502856
  33. GPC3 may be a candidate marker for detecting lung squamous cell carcinoma. PMID: 26345955
  34. study suggests that GPC3 is involved in HCC cell migration and motility through HS chain-mediated cooperation with the HGF/Met pathway, showing how HS targeting has potential therapeutic implications for liver cancer PMID: 26332121
  35. potential role of GPC3 in urothelial carcinogenesis warrants further investigation, especially the potential use of Glypican-3 for therapeutic and diagnostic purposes PMID: 25896897
  36. Downregulation of glypican-3 expression increases migration, invasion, and tumorigenicity of ovarian cancer. PMID: 25967456
  37. GPC3 expression is an independent prognostic factor for postoperative hepatocellular carcinoma PMID: 25432695
  38. Identify a GPC3-specific T-cell receptor. Expression of this receptor by T cells allows them to recognize and kill GPC3-positive hepatoma cells. PMID: 26052074
  39. High expression of glypican-3 is associated hepatoblastoma. PMID: 25735325
  40. GPC3 and E-cadherin expressions are not independent prognostic factors in CRC. PMID: 25619476
  41. In HCC patients, sGPC3N levels were significantly increased (mean/median, 405.16/236.19 pg mL(-1) ) compared to healthy controls (p < 0.0001), and 60% of HCC cases (69/115) showed sGPC3N levels that were higher than the upper normal limit. PMID: 25784484
  42. GPC3 contributes to hepatocellular carcinoma progression and metastasis through impacting epithelial-mesenchymal transition of cancer cells, and the effects of GPC3 are associated with ERK activation. PMID: 25572615
  43. Most cases of hepatoblastoma and yolk sac tumor, and some cases of other tumors were found to express GPC3. On the other hand, GPC3 was physiologically expressed during the fetal and neoinfantile period under 1 year of age. PMID: 25344940
  44. OPN, SPINK1, GPC3 and KNPA2 were significantly over-expressed in HCC tissues. These genes may be useful in developing future biomarkers and therapeutic strategies for HCC PMID: 25862856
  45. Data indicate that zinc-fingers and homeoboxes 2 (ZHX2) suppresses glypican 3 (GPC3) transcription by binding with its core promoter. PMID: 25195714
  46. propose that the structural changes generated by the lack of cleavage determine a change in the sulfation of the HS chains and that these hypersulfated chains mediate the interaction of the mutant GPC3 with Ptc PMID: 25653284
  47. GPC3 is associated with the HCC cell biological behavior. PMID: 25270552
  48. Data indicate that the triple stain of reticulin, glypican-3, and glutamine synthetae is useful in the differentiation of hepatocellular carcinoma, hepatic adenoma, and focal nodular hyperplasia. PMID: 25822763
  49. Data shows that GPC3 gene expression is downregulated in primary clear cell renal cell carcinoma; its overexpression arrest cells in G1 phase suggesting its role as tumor suppressor in clear cell renal cell carcinoma. PMID: 25168166
  50. This study demonstrated that highly expression of GPC3 could enrich hepatocellular carcinoma -related genes' mRNA expression and positive associate with dysplasia in cirrhotic livers. PMID: 25542894

Show More

Hide All

Involvement in disease
Simpson-Golabi-Behmel syndrome 1 (SGBS1)
Subcellular Location
Cell membrane; Lipid-anchor, GPI-anchor; Extracellular side.
Protein Families
Glypican family
Tissue Specificity
Highly expressed in lung, liver and kidney.
Database Links

HGNC: 4451

OMIM: 300037

KEGG: hsa:2719

STRING: 9606.ENSP00000377836

UniGene: Hs.644108

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*