Product Details

Purity

≥ 90% as determined by SDS-PAGE.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Human LAG3 at 2 μg/mL can bind Anti-LAG3 recombinant antibody(CSB-RA012719MA1HU). The EC50 is 2.306-2.731 ng/mL.

Target Names

LAG3

Uniprot No.

P18627

Alternative Names

Lymphocyte activation gene 3 protein; LAG-3; CD223; LAG3; FDC

Species

Homo sapiens (Human)

Source

Mammalian cell

Expression Region

23-434aa

Target Protein Sequence

LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPG

Mol. Weight

46.2 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

LAG-3 functions as an immune checkpoint receptor that negatively regulates T-cell activation and proliferation, making it a critical target for immuno-oncology research and therapeutic antibody development. This recombinant protein spans the extracellular domain (aa 23–434) and demonstrates quantifiable binding activity with an EC50 of 2.306–2.731 ng/mL against an anti-LAG-3 antibody in functional ELISA, confirming that the mammalian expression system has preserved the native conformational epitopes required for antibody recognition. The validated binding kinetics support its use in competitive inhibition assays, therapeutic antibody epitope mapping, and blocking antibody screening campaigns where accurate representation of native receptor structure is essential. With endotoxin levels below 1.0 EU/μg and purity exceeding 90%, this protein aligns with standards expected in surface plasmon resonance and biolayer interferometry experiments for affinity characterization of LAG-3-targeting biologics.

Target Background

Function

Lymphocyte activation gene 3 protein: Inhibitory receptor on antigen activated T-cells. Delivers inhibitory signals upon binding to ligands, such as FGL1. FGL1 constitutes a major ligand of LAG3 and is responsible for LAG3 T-cell inhibitory function. Following TCR engagement, LAG3 associates with CD3-TCR in the immunological synapse and directly inhibits T-cell activation. May inhibit antigen-specific T-cell activation in synergy with PDCD1/PD-1, possibly by acting as a coreceptor for PDCD1/PD-1. Negatively regulates the proliferation, activation, effector function and homeostasis of both CD8(+) and CD4(+) T-cells. Also mediates immune tolerance: constitutively expressed on a subset of regulatory T-cells (Tregs) and contributes to their suppressive function. Also acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation. Binds MHC class II (MHC-II); the precise role of MHC-II-binding is however unclear.; May function as a ligand for MHC class II (MHC-II) on antigen-presenting cells (APC), promoting APC activation/maturation and driving Th1 immune response.

Gene References into Functions

Results demonstrated that the expression of LAG3 in colorectal carcinoma tissue was significantly increased compared with the paracancerous tissue. It was mainly expressed at the edge of tumor tissues suggesting that LAG3 was expressed on tumorinfiltrating lymph node cells but not in colorectal cancer cells. PMID: 30272332
These results together suggested that LAG-3 is a marker of CD4(+) T cells with regulatory function; at the same time, LAG-3 might have limited the full suppressive potential of Treg cells. PMID: 29671649
Among the 89 patients, CD274, LAG3, and IDO1 expressions in TIICs were observed in 68.6% (61 cases), 13.5% (12), and 28.1% (25) of patients, respectively. CD274, CTLA4, and IDO1 were expressed in tumor cells of 24.7% (22 cases), 4.5% (4), and 72.0% (64) of patients, respectively. PMID: 29520442
LAG-3+ iTILs are enriched in estrogen receptor-negative breast cancers and represent an independent favorable prognostic factor. In addition, a high proportion of PD-1/PD-L1+ tumors are co-infiltrated with LAG-3+ TILs. PMID: 29045526
Squamous cell carcinomas escape immune surveillance via inducing chronic activation and exhaustion of CD8+ T Cells co-expressing PD-1 and LAG-3 inhibitory receptors. PMID: 27835902
Data suggest that blocking LAG3-MHC class II interactions is a potential therapeutic target in chronic lymphocytic leukemia. PMID: 28154084
LAG-3 expression was correlated with expression of PD-1 on TILs and expression of PD-L1 on tumor cells. Higher expression of LAG-3 on TILs was significantly correlated with higher expression of PD-1 on TILs and higher expression of PD-L1 on tumor cells. PMID: 28132868
the upregulation of others syncytial molecules, including LAG3, CTLA4, CD28 and CD3, assisting the formation of syncytia with APC cells. PMID: 27108398
LAG3-expressing CD4(+)CD25(-) T cells represent another regulatory immune cell type with potential to interfere with anti-tumor immunity. PMID: 28935468
Overexpression of lymphocyte activation gene-3 inhibits regulatory T cell responses in osteoarthritis PMID: 28800255
Egr2-driven cell surface proteins LAG-3 and 4-1BB can identify dysfunctional tumor antigen-specific CD8(+) TIL. PMID: 28115575
our data indicate that the evaluation of stromal TILs remains the most reliable immune prognostic marker in TNBC, and support the clinical evaluation of anti-PD-1/PD-L1 and anti-LAG-3 in a subset of patients with TNBC who have concurrent expression of both checkpoint receptors. PMID: 27912781
this review provides the translational rationale for targeting LAG3, as well as historical and current state of clinical trials utilizing LAG3 cancer immunomodulators PMID: 28258692
this study shows that LAG3 expressed on myeloid leukaemia cells possess the capacity to facilitate functional exhaustion in T helper cells PMID: 27565576
epigenetic modification on LAG-3 increased LAG-3(+) T cells and its immune regulatory roles in chronic osteomyelitis progression PMID: 28028751
Immune checkpoint proteins are co-inhibitory factors that can diminish the antigen-specific immune responses by attenuating the regulatory role of cytotoxic T-lymphocyte-associated protein 4, programmed cell death-1, lymphocyte-activation gene 3, and T-cell immunoglobulin mucin-3. PMID: 28349816
LAG3 binds alpha-synuclein preformed fibrils (PFF) with high affinity (dissociation constant = 77 nanomolar), whereas the alpha-syn monomer exhibited minimal binding. alpha-Syn-biotin PFF binding to LAG3 initiated alpha-syn PFF endocytosis, transmission, and toxicity. PMID: 27708076
An IL-27/Lag3 axis enhances Foxp3+ regulatory T cell-suppressive function and therapeutic efficacy. PMID: 26013006
LAG-3 is highly expressed in peripheral blood CD8+ T cells in chronic HBV-infected patients. PMID: 27053622
iNKT cytokine production is profoundly altered by both HIV infection and treatment, and LAG-3, but not PD-1, expression is associated with a reduction in iNKT IFNgamma production. PMID: 25810006
NFKB1, CD27, LAG3 and IKZF3 are new susceptibility genes for psoriasis. PMID: 25006012
The elevated expression of LAG-3 at the genital tract suggests it may regulate T-cell activation, and identify cells susceptible to HIV infection. The enrichment of LAG-3 on double negative T cells suggests LAG-3 may contribute to the immunoregulatory activity of these cells. PMID: 25154740
the LAG-3/MHC class II pathway may synergize with PD-1/PD ligand to enhance T cell-mediated immune responses. PMID: 25780040
LAG-3 trafficking from lysosomal compartments to the cell surface is dependent on the cytoplasmic domain through protein kinase C signaling in activated T cells. PMID: 25108024
These results suggest that LAG-3-mediated activation of plasmacytoid dendritic cells takes place in vivo at tumor sites, and it is in part responsible for directing an immune-suppressive environment. PMID: 24441096
Expression of LAG-3 is coincident with the impaired effector function of HBV-specific CD8(+) T cell in HCC patients. PMID: 23261718
our data suggest that the LAG-3-MHC II interaction could be viewed as a bidirectional immune escape pathway in melanoma PMID: 21441454
Multiple myeloma was associated with 2 SNPs in intron regions of LAG3 within 20 k base pairs 5' upstream of the candidate CD4 gene. The variant in LAG3 gene itself may play a role in susceptibility of MM. PMID: 20568250
Analysis identified a gene-set (LAG3, LPL, ZAP70) whose overexpression is assigned to unmutated immunoglobulin variable heavy chain region with 90% specificity. PMID: 20228263
LAG-3 defines an active CD4(+)CD25(high)Foxp3(+) regulatory T cell subset whose frequency is enhanced in the PBMCs of patients with cancer PMID: 20421648
Tumor-infiltrating NY-ESO-1-specific CD8+ T cells are negatively regulated by LAG-3 and PD-1 in human ovarian cancer. PMID: 20385810
MHC class II-mediated signals induced by the natural ligand, LAG-3, lead to complete maturation of monocyte-derived dendritic cells, which acquire the capacity to trigger naive T cells and drive polarized Th1 responses. PMID: 11937541
LAG-3 induces rapid protein phosphorylation of phospholipase Cgamma2 and p72syk as well as activation of phosphatidyl inositol 3-kinase/Akt, p42/44 extracellular signal-regulated protein kinase, and p38 mitogen-activated protein kinase pathways. PMID: 12775570
LAG3 may mediate sphingolipid metabolism PMID: 12825348
LAG-3 activates antigen-presenting cells through MHC class II signalling, leading to increased antigen-specific T-cell responses in vivo. PMID: 14644131
regulatory T cells and LAG-3 have pivotal roles in the suppression of EBV-specific cell-mediated immunity in Hodgkin lymphoma PMID: 16757686
The result, including a total of 2640 MS patients and 2194 controls shows no significant association with CD4 and LAG3 and MS. We conclude that these genes are of minor importance in regard of genetic predisposition to the MS. PMID: 17020785
Soluble human recombinant fusion protein (hLAG-3Ig) used in vitro as a single maturation agent induces phenotypic maturation of monocyte-derived dendritic cells and promotes the production of chemokines and TNF-alpha inflammatory cytokine. PMID: 18322184

Hide All

Subcellular Location

[Lymphocyte activation gene 3 protein]: Cell membrane; Single-pass type I membrane protein.; [Secreted lymphocyte activation gene 3 protein]: Secreted.

Tissue Specificity

Primarily expressed in activated T-cells and a subset of natural killer (NK) cells.

Database Links

HGNC: 6476

OMIM: 153337

KEGG: hsa:3902

STRING: 9606.ENSP00000203629

UniGene: Hs.409523

Code	CSB-MP012719HU3
Abbreviation	Recombinant Human LAG3 protein, partial (Active)
MSDS	MSDS Datasheet
Size	$136
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Human LAG3 at 2 μg/ml can bind Anti-LAG3 recombinant antibody(CSB-RA012719MA1HU). The EC₅₀ is 2.306-2.731 ng/mL. Biological Activity Assay
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Lymphocyte activation gene 3 protein (LAG3), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage