Recombinant Human Lymphocyte activation gene 3 protein (LAG3), partial (Active)

In Stock Promotion
Code CSB-MP012719HU3
Abbreviation Recombinant Human LAG3 protein, partial (Active)
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,100+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Activity
    Measured by its binding ability in a functional ELISA. Immobilized Human LAG3 at 2 μg/ml can bind Anti-LAG3 recombinant antibody(CSB-RA012719MA1HU). The EC50 is 2.306-2.731 ng/mL. Biological Activity Assay
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized Human LAG3 at 2 μg/mL can bind Anti-LAG3 recombinant antibody(CSB-RA012719MA1HU). The EC50 is 2.306-2.731 ng/mL.
Target Names
Uniprot No.
Alternative Names
Lymphocyte activation gene 3 protein; LAG-3; CD223; LAG3; FDC
Species
Homo sapiens (Human)
Source
Mammalian cell
Expression Region
23-434aa
Target Protein Sequence
LQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSGPPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPARRADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGRVPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGLPCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAIITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERLLGAAVYFTELSSPG
Mol. Weight
46.2 kDa
Protein Length
Partial
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant human LAG3, spanning residues 23–434 of isoform 1, is expressed in mammalian cells and purified to >90% purity by SDS-PAGE. Also known as Lymphocyte activation gene 3 protein, LAG-3, CD223, LAG3, or FDC, this fragment (~46.1 kDa) carries a C-terminal 10×His tag for easy purification. It activity has been validated.


Potential Applications

(Note: The following applications are based on the known biological functions of this protein and scientific literature predictions. Our company has not validated all listed applications, and specific effects need to be verified by customers according to their experimental requirements. We recommend conducting small-scale preliminary experiments before formal studies.)

Mechanism Overview

LAG3 (Lymphocyte Activation Gene-3) is an important immune checkpoint receptor primarily expressed on activated T cells, regulatory T cells, and NK cells. By binding to MHC-II molecules, LAG3 negatively regulates T cell activation and proliferation, playing a key role in maintaining immune homeostasis and preventing excessive immune responses [1]. As an emerging immunotherapy target, LAG3 is pivotal in tumor immune evasion mechanisms [2].

Main Application Areas

1. Immune Checkpoint Functional Studies

Applications & Experimental Use:
This recombinant protein (purity >90%, endotoxin <1.0 EU/μg) can be utilized in in vitro binding experiments to investigate the interaction mechanism between LAG3 and its ligand MHC-II. Techniques such as ELISA and surface plasmon resonance (SPR) can be employed to measure binding affinity and kinetic parameters. The C-terminal 10×His tag facilitates both protein purification and detection, while expression in a mammalian cell system ensures proper folding and post-translational modifications.

Scientific Basis:
Studies indicate that LAG3 has a binding affinity for MHC-II molecules that is 100 times greater than that of the CD4 molecule, underpinning its key role in regulating T cell activation [3]. The extracellular domain of LAG3 specifically binds to the D1 domain of MHC-II, thereby inhibiting T cell receptor signaling [4].


2. Anti-LAG3 Antibody Drug Development and Screening

Applications & Experimental Use:
This recombinant protein can serve as an antigen for screening, characterizing, and quality controlling anti-LAG3 monoclonal antibodies. Competitive binding assays are used to evaluate antibody specificity, while flow cytometry or immunohistochemistry can verify antibody functionality. The product has been functionally validated by ELISA, with an EC50 value ranging from 2.306 to 2.731 ng/mL, ensuring experimental reliability and reproducibility.

Scientific Basis:
Anti-LAG3 antibodies, such as relatlimab, have received FDA approval for the treatment of melanoma, demonstrating promising clinical outcomes [5]. Multiple clinical trials have confirmed that the combination of LAG3 antibodies with PD-1 inhibitors can significantly enhance the efficacy of tumor immunotherapy [6].


3. Tumor Immune Microenvironment Studies

Applications & Experimental Use:
This protein is used to construct in vitro tumor immune microenvironment models to study the role of LAG3 in T cell exhaustion and tumor immune evasion. Co-culture experiments can monitor the effects of LAG3 on T cell proliferation, cytokine secretion, and cytotoxicity. Its high purity and low endotoxin levels ensure that experimental results remain free from confounding contaminants.

Scientific Basis:
LAG3 is highly expressed on tumor-infiltrating lymphocytes and is closely linked with the T cell exhaustion state [7]. Research shows that LAG3-positive TILs correlate with poor patient prognosis, making LAG3 an important biomarker in immunotherapy [8].


4. Mechanistic Studies of Immune Cell Function Regulation

Applications & Experimental Use:
This protein is employed to investigate the role of LAG3 in regulating the function of regulatory T cells (Tregs). By adding recombinant LAG3 protein, researchers can observe its effects on Treg-mediated suppression. Additionally, it can be used in T cell activation experiments to analyze the modulatory impact of LAG3 on T cell proliferation, differentiation, and effector functions. The use of a mammalian expression system ensures that the protein maintains its native conformation and bioactivity.

Scientific Basis:
LAG3 is constitutively expressed on CD4+CD25+ Treg cells and is crucial for their suppressive function [9]. Mice lacking LAG3 exhibit heightened T cell responses and a predisposition to autoimmune disorders [10].


5. Development of Biomarker Detection Methods

Applications & Experimental Use:
This protein can be used as a standard in developing quantitative detection methods for LAG3, including ELISA and electrochemiluminescence immunoassays. It is applicable for detecting soluble LAG3 (sLAG3) levels in serum, plasma, or tissue samples. The His tag aids in establishing standard curves and quality control, ensuring the accuracy and reproducibility of the detection methods.

Scientific Basis:
Serum levels of sLAG3 are associated with the severity and prognosis of various diseases, making it a potential diagnostic and monitoring biomarker. Studies have demonstrated that sLAG3 can serve as an effective indicator for evaluating the outcomes of immunotherapy [11].

References

[1] Triebel, F., Jitsukawa, S., Baixeras, E., Roman-Roman, S., Genevee, C., Viegas-Pequignot, E., & Hercend, T. (1990). LAG-3, a novel lymphocyte activation gene closely related to CD4. Journal of Experimental Medicine, 171(5), 1393-1405.
[2] Maruhashi, T., Okazaki, I. M., Sugiura, D., Takahashi, S., Maeda, T. K., Shimizu, K., & Okazaki, T. (2018). LAG-3 inhibits the activation of CD4+ T cells that recognize stable pMHCII through its conformation-dependent recognition of pMHCII. Nature Immunology, 19(12), 1415-1426.
[3] Huard, B., Prigent, P., Tournier, M., Bruniquel, D., & Triebel, F. (1995). CD4/major histocompatibility complex class II interaction analyzed with CD4- and lymphocyte activation gene-3 (LAG-3)-Ig fusion proteins. European Journal of Immunology, 25(9), 2718-2721.
[4] Baixeras, E., Huard, B., Miossec, C., Jitsukawa, S., Martin, M., Hercend, T., & Triebel, F. (1992). Characterization of the lymphocyte activation gene 3-encoded protein. A new ligand for human leukocyte antigen class II antigens. Journal of Experimental Medicine, 176(2), 327-337.
[5] Tawbi, H. A., Schadendorf, D., Lipson, E. J., Ascierto, P. A., Matamala, L., Castillo Gutiérrez, E., ... & Long, G. V. (2022). Relatlimab and nivolumab versus nivolumab in untreated advanced melanoma. New England Journal of Medicine, 386(1), 24-34.
[6] Woo, S. R., Turnis, M. E., Goldberg, M. V., Bankoti, J., Selby, M., Nirschl, C. J., ... & Drake, C. G. (2012). Immune inhibitory molecules LAG-3 and PD-1 synergistically regulate T-cell function to promote tumoral immune escape. Cancer Research, 72(4), 917-927.
[7] Shi, A. P., Tang, X. Y., Xiong, Y. L., Zheng, K. F., Liu, Y. J., Shi, X. G., Lv, Y., Jiang, T., Ma, N., & Zhao, J. B. (2022). Immune checkpoint LAG3 and its ligand FGL1 in cancer. Frontiers in Immunology, 12, 785091.
[8] Friedlaender, A., Tsantoulis, P., Chevallier, M., De Velasco, M. A., Addeo, A., & Tsoukalas, N. (2021). The multi-dimensional impact of LAG-3 on cancer immunotherapy. Cancer Letters, 518, 92-101.
[9] Liang, B., Workman, C., Lee, J., Chew, C., Dale, B. M., Colonna, L., ... & Vignali, D. A. (2008). Regulatory T cells inhibit dendritic cells by lymphocyte activation gene-3 engagement of MHC class II. Journal of Immunology, 180(9), 5916-5926.
[10] Workman, C. J., Dugger, K. J., & Vignali, D. A. (2002). Cutting edge: molecular analysis of the negative regulatory function of lymphocyte activation gene-3. Journal of Immunology, 169(10), 5392-5395.
[11] Solinas, C., Migliori, E., De Silva, P., & Willard-Gallo, K. (2019). LAG3: the biological processes that motivate targeting this immune checkpoint molecule in human cancer. Cancers, 11(8), 1213.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Lymphocyte activation gene 3 protein: Inhibitory receptor on antigen activated T-cells. Delivers inhibitory signals upon binding to ligands, such as FGL1. FGL1 constitutes a major ligand of LAG3 and is responsible for LAG3 T-cell inhibitory function. Following TCR engagement, LAG3 associates with CD3-TCR in the immunological synapse and directly inhibits T-cell activation. May inhibit antigen-specific T-cell activation in synergy with PDCD1/PD-1, possibly by acting as a coreceptor for PDCD1/PD-1. Negatively regulates the proliferation, activation, effector function and homeostasis of both CD8(+) and CD4(+) T-cells. Also mediates immune tolerance: constitutively expressed on a subset of regulatory T-cells (Tregs) and contributes to their suppressive function. Also acts as a negative regulator of plasmacytoid dendritic cell (pDCs) activation. Binds MHC class II (MHC-II); the precise role of MHC-II-binding is however unclear.; May function as a ligand for MHC class II (MHC-II) on antigen-presenting cells (APC), promoting APC activation/maturation and driving Th1 immune response.
Gene References into Functions
  1. Results demonstrated that the expression of LAG3 in colorectal carcinoma tissue was significantly increased compared with the paracancerous tissue. It was mainly expressed at the edge of tumor tissues suggesting that LAG3 was expressed on tumorinfiltrating lymph node cells but not in colorectal cancer cells. PMID: 30272332
  2. These results together suggested that LAG-3 is a marker of CD4(+) T cells with regulatory function; at the same time, LAG-3 might have limited the full suppressive potential of Treg cells. PMID: 29671649
  3. Among the 89 patients, CD274, LAG3, and IDO1 expressions in TIICs were observed in 68.6% (61 cases), 13.5% (12), and 28.1% (25) of patients, respectively. CD274, CTLA4, and IDO1 were expressed in tumor cells of 24.7% (22 cases), 4.5% (4), and 72.0% (64) of patients, respectively. PMID: 29520442
  4. LAG-3+ iTILs are enriched in estrogen receptor-negative breast cancers and represent an independent favorable prognostic factor. In addition, a high proportion of PD-1/PD-L1+ tumors are co-infiltrated with LAG-3+ TILs. PMID: 29045526
  5. Squamous cell carcinomas escape immune surveillance via inducing chronic activation and exhaustion of CD8+ T Cells co-expressing PD-1 and LAG-3 inhibitory receptors. PMID: 27835902
  6. Data suggest that blocking LAG3-MHC class II interactions is a potential therapeutic target in chronic lymphocytic leukemia. PMID: 28154084
  7. LAG-3 expression was correlated with expression of PD-1 on TILs and expression of PD-L1 on tumor cells. Higher expression of LAG-3 on TILs was significantly correlated with higher expression of PD-1 on TILs and higher expression of PD-L1 on tumor cells. PMID: 28132868
  8. the upregulation of others syncytial molecules, including LAG3, CTLA4, CD28 and CD3, assisting the formation of syncytia with APC cells. PMID: 27108398
  9. LAG3-expressing CD4(+)CD25(-) T cells represent another regulatory immune cell type with potential to interfere with anti-tumor immunity. PMID: 28935468
  10. Overexpression of lymphocyte activation gene-3 inhibits regulatory T cell responses in osteoarthritis PMID: 28800255
  11. Egr2-driven cell surface proteins LAG-3 and 4-1BB can identify dysfunctional tumor antigen-specific CD8(+) TIL. PMID: 28115575
  12. our data indicate that the evaluation of stromal TILs remains the most reliable immune prognostic marker in TNBC, and support the clinical evaluation of anti-PD-1/PD-L1 and anti-LAG-3 in a subset of patients with TNBC who have concurrent expression of both checkpoint receptors. PMID: 27912781
  13. this review provides the translational rationale for targeting LAG3, as well as historical and current state of clinical trials utilizing LAG3 cancer immunomodulators PMID: 28258692
  14. this study shows that LAG3 expressed on myeloid leukaemia cells possess the capacity to facilitate functional exhaustion in T helper cells PMID: 27565576
  15. epigenetic modification on LAG-3 increased LAG-3(+) T cells and its immune regulatory roles in chronic osteomyelitis progression PMID: 28028751
  16. Immune checkpoint proteins are co-inhibitory factors that can diminish the antigen-specific immune responses by attenuating the regulatory role of cytotoxic T-lymphocyte-associated protein 4, programmed cell death-1, lymphocyte-activation gene 3, and T-cell immunoglobulin mucin-3. PMID: 28349816
  17. LAG3 binds alpha-synuclein preformed fibrils (PFF) with high affinity (dissociation constant = 77 nanomolar), whereas the alpha-syn monomer exhibited minimal binding. alpha-Syn-biotin PFF binding to LAG3 initiated alpha-syn PFF endocytosis, transmission, and toxicity. PMID: 27708076
  18. An IL-27/Lag3 axis enhances Foxp3+ regulatory T cell-suppressive function and therapeutic efficacy. PMID: 26013006
  19. LAG-3 is highly expressed in peripheral blood CD8+ T cells in chronic HBV-infected patients. PMID: 27053622
  20. iNKT cytokine production is profoundly altered by both HIV infection and treatment, and LAG-3, but not PD-1, expression is associated with a reduction in iNKT IFNgamma production. PMID: 25810006
  21. NFKB1, CD27, LAG3 and IKZF3 are new susceptibility genes for psoriasis. PMID: 25006012
  22. The elevated expression of LAG-3 at the genital tract suggests it may regulate T-cell activation, and identify cells susceptible to HIV infection. The enrichment of LAG-3 on double negative T cells suggests LAG-3 may contribute to the immunoregulatory activity of these cells. PMID: 25154740
  23. the LAG-3/MHC class II pathway may synergize with PD-1/PD ligand to enhance T cell-mediated immune responses. PMID: 25780040
  24. LAG-3 trafficking from lysosomal compartments to the cell surface is dependent on the cytoplasmic domain through protein kinase C signaling in activated T cells. PMID: 25108024
  25. These results suggest that LAG-3-mediated activation of plasmacytoid dendritic cells takes place in vivo at tumor sites, and it is in part responsible for directing an immune-suppressive environment. PMID: 24441096
  26. Expression of LAG-3 is coincident with the impaired effector function of HBV-specific CD8(+) T cell in HCC patients. PMID: 23261718
  27. our data suggest that the LAG-3-MHC II interaction could be viewed as a bidirectional immune escape pathway in melanoma PMID: 21441454
  28. Multiple myeloma was associated with 2 SNPs in intron regions of LAG3 within 20 k base pairs 5' upstream of the candidate CD4 gene. The variant in LAG3 gene itself may play a role in susceptibility of MM. PMID: 20568250
  29. Analysis identified a gene-set (LAG3, LPL, ZAP70) whose overexpression is assigned to unmutated immunoglobulin variable heavy chain region with 90% specificity. PMID: 20228263
  30. LAG-3 defines an active CD4(+)CD25(high)Foxp3(+) regulatory T cell subset whose frequency is enhanced in the PBMCs of patients with cancer PMID: 20421648
  31. Tumor-infiltrating NY-ESO-1-specific CD8+ T cells are negatively regulated by LAG-3 and PD-1 in human ovarian cancer. PMID: 20385810
  32. MHC class II-mediated signals induced by the natural ligand, LAG-3, lead to complete maturation of monocyte-derived dendritic cells, which acquire the capacity to trigger naive T cells and drive polarized Th1 responses. PMID: 11937541
  33. LAG-3 induces rapid protein phosphorylation of phospholipase Cgamma2 and p72syk as well as activation of phosphatidyl inositol 3-kinase/Akt, p42/44 extracellular signal-regulated protein kinase, and p38 mitogen-activated protein kinase pathways. PMID: 12775570
  34. LAG3 may mediate sphingolipid metabolism PMID: 12825348
  35. LAG-3 activates antigen-presenting cells through MHC class II signalling, leading to increased antigen-specific T-cell responses in vivo. PMID: 14644131
  36. regulatory T cells and LAG-3 have pivotal roles in the suppression of EBV-specific cell-mediated immunity in Hodgkin lymphoma PMID: 16757686
  37. The result, including a total of 2640 MS patients and 2194 controls shows no significant association with CD4 and LAG3 and MS. We conclude that these genes are of minor importance in regard of genetic predisposition to the MS. PMID: 17020785
  38. Soluble human recombinant fusion protein (hLAG-3Ig) used in vitro as a single maturation agent induces phenotypic maturation of monocyte-derived dendritic cells and promotes the production of chemokines and TNF-alpha inflammatory cytokine. PMID: 18322184

Show More

Hide All

Subcellular Location
[Lymphocyte activation gene 3 protein]: Cell membrane; Single-pass type I membrane protein.; [Secreted lymphocyte activation gene 3 protein]: Secreted.
Tissue Specificity
Primarily expressed in activated T-cells and a subset of natural killer (NK) cells.
Database Links

HGNC: 6476

OMIM: 153337

KEGG: hsa:3902

STRING: 9606.ENSP00000203629

UniGene: Hs.409523

CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*