Purity
            Greater than 95% as determined by SDS-PAGE.
           
                              
            Endotoxin
            Less than 1.0 EU/μg as determined by LAL method.
           
                              
            Activity
            Measured by its ability to catalyze the reduction of insulin.The reaction leads to precipitation, which can be measured by absorbance at 650 nm. The specific activity is 0.2-1 Abs/min/mg as measured under the described conditions.
           
                              
                                                  
                                        
            Research Area
            Signal Transduction
           
                              
            Alternative Names
            
              ADF; ATL derived factor; ATL-derived factor; DKFZp686B1993; MGC61975; SASP; Surface associated sulphydryl protein; Surface-associated sulphydryl protein; testicular tissue protein Li 199; THIO_HUMAN; Thioredoxin; thioredoxin delta 3; TRDX; TRX 1; Trx; TRX1; TXN; TXN delta 3; TXN protein; zgc:92903
             
           
                                        
            Species
            Homo sapiens (Human)
           
                              
                              
            Expression Region
            1-105aa
           
                              
            Complete Sequence            
            MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV            
           
                              
                              
            Protein Length
            Full Length
           
                                        
            Tag Info
            
                                          N-terminal 6xHis-tagged
                          
           
                              
            Form
            
                            Liquid or Lyophilized powder                                        
           
                    
            Buffer
                          Lyophilized from a 0.2 μm filtered 20mM PB, 1mM EDTA, 2mM DTT, pH 7.2.                          
           
                                                  
                    
            Storage Condition
            Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid
              repeated freeze-thaw
              cycles.
           
                              
            Shelf Life
            The shelf life is related to many factors, storage state, buffer ingredients, storage
              temperature
              and the stability of the protein itself.
              Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
              form is 12 months at -20°C/-80°C. 
           
                    
            Lead Time
             Basically, we can dispatch the products
              out in 1-3
              working days after receiving your orders. Delivery time may differ from different purchasing way or
              location, please kindly consult your local distributors for specific delivery time.
              Note: All of our proteins are default shipped with
                normal blue ice packs, if you request to ship with dry ice, please communicate with us in advance
                and extra fees will be charged.            
           
                    
            Datasheet & COA
             Please contact us to get it.