Purity
Greater than 95% as determined by SDS-PAGE.
Endotoxin
Less than 1.0 EU/ug as determined by LAL method.
Activity
Measured by its binding ability in a functional ELISA. Immobilized TNFRSF9 at 2 μg/mL can bind TNFSF9(CSB-MP023997HU1), the EC50 is 1.011-2.429 ng/mL.
Alternative Names
(4-1BB ligand receptor) (CDw137) (T-cell antigen 4-1BB homolog) (T-cell antigen ILA) (CD antigen CD137)
Molecular Characterization
Species
Homo sapiens (Human)
Expression Region
24-186aa
Target Protein Sequence
LQDPCSNCPAGTFCDNNRNQICSPCPPNSFSSAGGQRTCDICRQCKGVFRTRKECSSTSNAECDCTPGFHCLGAGCSMCEQDCKQGQELTKKGCKDCCFGTFNDQKRGICRPWTNCSLDGKSVLVNGTKERDVVCGPSPADLSPGASSVTPPAPAREPGHSPQ
Tag Info
C-terminal 10xHis-tagged
Form
Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Basically, we can dispatch the products out in 3-7 working days after receiving your orders. Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
Human TNFRSF9, amino acid Leu24-Gln186, with an N-terminal linker and a C-terminal 10xHis-tag, was expressed in the mammalian cells. The product is the recombinant human TNFRSF9 protein. It is biologically active, high in purity (>95%), and low in endotoxin content (<1EU/µg). In the functional ELISA, this TNFRSF9 protein can bind to the TNFSF9 with the EC50 of 1.011-2.429 ng/mL. It has an apparent molecular weight of approximately 28 kDa on the gel. This TNFRSF0 protein may find use in cancer research.
TNFRSF9, also called 4-1BB or CD137, is an inducible co-stimulatory receptor mainly expressed on activated T cells. TNFRSF9/TNFSF9 signaling plays an important role in the activation, proliferation, differentiation, and apoptosis of T cells, as well as the pathogenesis of some autoimmune diseases. TNFRSF9/TNFSF9 signaling also mediates anti-tumor immune responses of immune cells such as T cells and NK cells. TNFRSF9 is widely used in second-generation CAR-T cell therapy, and TNFRSF9-related bispecific antibody has been developed for clinical research in cancer treatment.