Product Details

Purity

≥ 95% as determined by SDS-PAGE.
≥ 90% as determined by SEC-HPLC.

Endotoxin

Less than 1.0 EU/ug as determined by LAL method.

Activity

Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2b at 2 μg/mL can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC50 is 3.560-4.235 ng/mL.

Target Names

Acvr2b

Uniprot No.

P27040

Alternative Names

Activin receptor type-2B;EC: 2.7.11.30; Activin receptor type IIB (ACTR-IIB); Acvr2b

Species

Mus musculus (Mouse)

Source

Mammalian cell

Expression Region

19-137aa

Target Protein Sequence

SGRGEAETRECIYYNANWELERTNQSGLERCEGEQDKRLHCYASWRNSSGTIELVKKGCWLDDFNCYDRQECVATEENPQVYFCCCEGNFCNERFTHLPEPGGPEVTYEPPPTAPTLLT

Mol. Weight

15.2 kDa

Protein Length

Partial

Tag Info

C-terminal 10xHis-tagged

Form

Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

Activin receptor type-2B mediates signaling by activin and related TGF-β superfamily ligands, making it a critical node in pathways governing muscle homeostasis, metabolism, and developmental processes. This extracellular domain construct (aa 19–137) produced in mammalian cells demonstrates quantifiable antibody-binding activity with an EC50 of 3.560–4.235 ng/mL in functional ELISA, confirming that the recombinant protein retains conformational epitopes required for receptor-ligand interaction studies and therapeutic antibody screening. The mammalian expression system supports native glycosylation and disulfide bond formation, features that align with standards expected in surface plasmon resonance and biolayer interferometry experiments for affinity characterization of blocking antibodies or competitive inhibitors. With purity exceeding 95% by SDS-PAGE and endotoxin levels below 1.0 EU/μg, this protein provides a suitable basis for drug discovery assays targeting Acvr2b, including small-molecule inhibitor screening and epitope mapping of biologics designed to modulate activin signaling in metabolic or muscle-wasting disease models.

Target Background

Function

Transmembrane serine/threonine kinase activin type-2 receptor forming an activin receptor complex with activin type-1 serine/threonine kinase receptors (ACVR1, ACVR1B or ACVR1c). Transduces the activin signal from the cell surface to the cytoplasm and is thus regulating many physiological and pathological processes including neuronal differentiation and neuronal survival, hair follicle development and cycling, FSH production by the pituitary gland, wound healing, extracellular matrix production, immunosuppression and carcinogenesis. Activin is also thought to have a paracrine or autocrine role in follicular development in the ovary. Within the receptor complex, the type-2 receptors act as a primary activin receptors (binds activin-A/INHBA, activin-B/INHBB as well as inhibin-A/INHA-INHBA). The type-1 receptors like ACVR1B act as downstream transducers of activin signals. Activin binds to type-2 receptor at the plasma membrane and activates its serine-threonine kinase. The activated receptor type-2 then phosphorylates and activates the type-1 receptor. Once activated, the type-1 receptor binds and phosphorylates the SMAD proteins SMAD2 and SMAD3, on serine residues of the C-terminal tail. Soon after their association with the activin receptor and subsequent phosphorylation, SMAD2 and SMAD3 are released into the cytoplasm where they interact with the common partner SMAD4. This SMAD complex translocates into the nucleus where it mediates activin-induced transcription. Inhibitory SMAD7, which is recruited to ACVR1B through FKBP1A, can prevent the association of SMAD2 and SMAD3 with the activin receptor complex, thereby blocking the activin signal. Activin signal transduction is also antagonized by the binding to the receptor of inhibin-B via the IGSF1 inhibin coreceptor.

Gene References into Functions

The current study reveals that ActRIIB activation by activin A induces muscle catabolism primarily through the activation of p38beta MAPK-mediated catabolic signalling that activates the ubiquitin-proteasome pathway and the autophagy-lysosome pathway. PMID: 27897407
The endoplasmic reticulum stress stress and unfolded protein response are increased in mdx muscle. However, these processes are not distinctly improved by voluntary exercise or blocking activin receptor IIB ligands and thus do not appear to be optimal therapeutic choices for improving proteostasis in Duchenne muscular dystrophy. PMID: 27554968
Data, including data from studies using transgenic mice, suggest that osteoblasts deficient in Acvr2A exhibit un-characteristic features; osteoclasts deficient in Acvr2A or Acvr2B or both appear normal. Acvr2A-deficient mice exhibit significantly increased femoral trabecular bone volume at 6 weeks of age; Acvr2B-deficient mice exhibit no significant change in any bone parameter. PMID: 28659341
Differential muscle hypertrophy is associated with satellite cell numbers and Akt pathway activation following activin type IIB receptor inhibition in Mtm1 PMID: 24726641
ActRIIB inhibition enhanced energy expenditure only at ambient temperature or in the cold, where nonshivering thermogenesis is minimal, suggesting that brown fat activation plays a prominent role in the metabolic actions of ActRIIB inhibition. PMID: 22586266
findings best fit a model in which BMP3, produced by mature bone cells, acts to reduce BMP signaling through Acvr2b in skeletal progenitor cells, limiting their differentiation to mature osteoblasts PMID: 22074949
Functional redundancy in osteoblast differentiation is observed between bone morphogenetic protein receptor BMPR-II and ActR-IIB. PMID: 21503889
Inhibition of activin receptor type IIB increases strength and lifespan in myotubularin-deficient mice. PMID: 21281811
Akt isoforms are not essential for for the ability of ActRIIB inhibition to regulate muscle size and function . PMID: 20856813
ActRIIB plays a role in the specification of left-sidedness in developing mice PMID: 12112458
Activin type IIB(ActRIIB) and its subfamily receptor, Activin type IIA (ActRIIA), cooperatively mediate the Gdf11 signal in patterning the axial vertebrae PMID: 12414726
ActRIIB is expressed in the early development of thymocytes. PMID: 16477644
genetic evidence strongly suggested that ActRIIB and Smad2 function in the same signaling pathway to regulate axial patterning and pancreas islet formation by means of a threshold mechanism. PMID: 17849440
expression of MSTN and its associated binding proteins can be modulated in adipose tissue and skeletal muscle by chronic obesity PMID: 18334608
Data suggest that BMP3 exerts its effects in the skeleton by altering signaling through ActRIIB in chondrocytes and the periosteum, and this results in defects in bone collar formation and late hypertrophic chondrocyte maturation. PMID: 19653325

Hide All

Subcellular Location

Cell membrane; Single-pass type I membrane protein.

Protein Families

Protein kinase superfamily, TKL Ser/Thr protein kinase family, TGFB receptor subfamily

Database Links

KEGG: mmu:11481

STRING: 10090.ENSMUSP00000126108

UniGene: Mm.390239

Code	CSB-MP001261MO1
Abbreviation	Recombinant Mouse ACVR2B protein, partial (Active)
MSDS	MSDS Datasheet
Size	$128
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Activity Measured by its binding ability in a functional ELISA. Immobilized Mouse Acvr2b at 2 μg/ml can bind Anti-ACVR2A&ACVR2B recombinant antibody (CSB-RA623829MA1HU). The EC₅₀ is 3.560-4.235 ng/mL. Biological Activity Assay The purity of ACVR2B was greater than 90% as determined by SEC-HPLC
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Mouse Activin receptor type-2B (Acvr2b), partial (Active)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage