Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

IGF2R

Uniprot No.

P08169

Research Area

Immunology

Species

Bos taurus (Bovine)

Source

Yeast

Expression Region

628-772aa

Target Protein Sequence

LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

17.1 kDa

Protein Length

Partial

Tag Info

Tag-Free

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The gene fragment encoding the desired region of the bovine IGF2R protein (628-772aa) is inserted into a suitable expression vector specifically designed for yeast expression. The vector contains yeast-specific regulatory elements, such as a promoter and terminator, to drive efficient expression. The constructed expression vector is introduced into the yeast host cells using a transformation method. The transformed cells that incorporate the recombinant plasmid DNA into their genome are selected using a selectable marker and then propagated in a culture medium suitable for yeast growth and protein expression. The host yeast cells utilize their cellular machinery to synthesize the recombinant IGF2R protein and are lysed to release the intracellular contents, including the expressed recombinant IGF2R protein. The recombinant bovine IGF2R protein is purified from the cell lysate and is analyzed to determine its purity through SDS-PAGE analysis. Its purity is over 90%, and it migrates onto the band of 17 kDa molecular weight on the gel.

Target Background

Function

Mediates the transport of phosphorylated lysosomal enzymes from the Golgi complex and the cell surface to lysosomes. Lysosomal enzymes bearing phosphomannosyl residues bind specifically to mannose-6-phosphate receptors in the Golgi apparatus and the resulting receptor-ligand complex is transported to an acidic prelysosomal compartment where the low pH mediates the dissociation of the complex. The receptor is then recycled back to the Golgi for another round of trafficking through its binding to the retromer. This receptor also binds IGF2. Acts as a positive regulator of T-cell coactivation by binding DPP4.

Gene References into Functions

suggest that the insulin like growth factor 2 receptor(IGF2R) gene polymorphisms could be useful genetic markers for dairy production traits in cattle PMID: 29785901
study hypothesizes that reduced granulosa cell insulin-like growth factor II receptor expression in F2 follicles of Twinner cows may play a role in the development of 2 or more dominant follicles PMID: 24209503
imprinting of Bos taurus IGF2R is similar to mouse except in placenta, which could indicate an effect of reproductive strategy PMID: 23593146
Increases in CYP19A1 and FSHR mRNA expression and decreases in IGF2R mRNA expression in follicles of Twinners support the hypothesis that increased follicular development and steroidogenesis result from increased extra-ovarian IGF-1 production. PMID: 22266997
Sex-sorting procedure by flow cytometry did not affect the overall DNA methylation patterns of the IGF2 and IGF2R genes, although individual variation in their methylation patterns among bulls was observed. PMID: 22128039
Study demonstrates associations between IGF2R polymorphisms and growth- and body-related traits in cattle. PMID: 22221028
Data describes the long-term changes to skeletal muscle growth and IGF1, 2, 1R, and 2R mRNA expression in progeny after exposure to high and low levels of maternal nutrient intake during the first two trimesters of gestation in the bovine. PMID: 21056085
Expression and binding properties of mannose-6-phosphate receptors CD-MPR and CI-MPR differ during perinatal development in rat liver. PMID: 12127995
the interaction between uPAR and Man-6-P/IGF2R is a low percentage binding event and that suPAR and full-length uPAR bind the Man-6-P/IGF2R by different mechanisms. PMID: 12665524
Results describe the crystal structure of the N-terminal 432 residues of the cation-independent mannose 6-phosphate receptor, which encompass three out of the 15 repetitive domains of its extracytoplasmic region. PMID: 15085180
crystal structure of the N-terminal 432 residues reveals the unique architecture of binding pocket and provides insight into recognition of a variety of mannose-containing sugars PMID: 15169779
CI-MPR contains a third Man-6-P recognition site that is located in domain 5 and that exhibits lower affinity than the carbohydrate-binding sites present in domains 1-3 and 9 PMID: 15252023
The methylation at Igf-2r imprinting control region showed significant variation in tissues, such as blood, liver, brain, heart and heart, and suggested that Igf-2r imprinting was tissue-specifically regulated. PMID: 17150312
The role of insulin-like growth factor 2 (IGF2) and the regulation of the IGF2 receptor (IGF2R) during follicular development were studied. PMID: 17360960
Placental expression of IGF-IIR mRNA was greater for Nuclear transfer-derived than in vivo-derived embryos. PMID: 17628655
study to assess the mRNA expression of IGF-I, IGF-II, IGF-IR and IGF-IIR in bovine oocytes and different stages of preimplantation embryos PMID: 19013732
Variable pattern of IGF2R allelic expression in major organs such as the brain, cotyledon, heart, liver, lung, spleen, kidney and intercotyledon was observed using a G/A transition in the 3'UTR of IGF2R PMID: 19217227

Hide All

Subcellular Location

Golgi apparatus membrane; Single-pass type I membrane protein. Endosome membrane; Single-pass type I membrane protein.

Protein Families

MRL1/IGF2R family

Database Links

KEGG: bta:281849

STRING: 9913.ENSBTAP00000037502

UniGene: Bt.4977

Code	CSB-YP011093BO
Abbreviation	Recombinant Bovine IGF2R protein, partial
MSDS	MSDS Datasheet
Size	$602
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Bovine Cation-independent mannose-6-phosphate receptor (IGF2R), partial

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage