Purity
Greater than 90% as determined by SDS-PAGE.
Species
Bos taurus (Bovine)
Expression Region
628-772aa
Target Protein Sequence
LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
The gene fragment encoding the desired region of the bovine IGF2R protein (628-772aa) is inserted into a suitable expression vector specifically designed for yeast expression. The vector contains yeast-specific regulatory elements, such as a promoter and terminator, to drive efficient expression. The constructed expression vector is introduced into the yeast host cells using a transformation method. The transformed cells that incorporate the recombinant plasmid DNA into their genome are selected using a selectable marker and then propagated in a culture medium suitable for yeast growth and protein expression. The host yeast cells utilize their cellular machinery to synthesize the recombinant IGF2R protein and are lysed to release the intracellular contents, including the expressed recombinant IGF2R protein. The recombinant bovine IGF2R protein is purified from the cell lysate and is analyzed to determine its purity through SDS-PAGE analysis. Its purity is over 90%, and it migrates onto the band of 17 kDa molecular weight on the gel.
