Purity
Greater than 90% as determined by SDS-PAGE.
Species
Bos taurus (Bovine)
Expression Region
628-772aa
Target Protein Sequence
LSRTEGDNCTVFDSQAGFSFDLTPLTKKDAYKVETDKYEFHINVCGPVSVGACPPDSGACQVSRSDRKSWNLGRSNAKLSYYDGMIQLTYRDGTPYNNEKRTPRATLITFLCDRDAGVGFPEYQEEDNSTYNFRWYTSYACPEEP
Note: The complete sequence including tag
sequence, target protein sequence and linker sequence could be provided upon request.
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that
we have in stock, however, if you have any special requirement for the format, please remark your
requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw
cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature
and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized
form is 12 months at -20°C/-80°C.
Lead Time
Delivery time may differ from different purchasing way or location, please kindly consult your local distributors for specific delivery time.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description
To express the recombinant bovine cation-independent mannose-6-phosphate receptor (IGF2R) in yeast, the gene fragment encoding the specific region of bovine IGF2R, 628-772 amino acids, is fused with a C-terminal 6xHis-tag and inserted into a specialized expression vector designed for yeast systems. This vector incorporates yeast-specific regulatory elements, including a promoter and terminator, to drive efficient expression of the recombinant protein. The constructed expression vector is then introduced into yeast host cells through a transformation process. The transformed incorporating the recombinant plasmid DNA into their genome cells are selected using a selectable marker. The selected yeast cells are grown in a suitable culture medium that supports their growth and protein expression. Within the yeast cells, the recombinant IGF2R protein is synthesized utilizing the host's cellular machinery. Upon completion, the yeast cells are lysed, releasing the intracellular contents, including the expressed recombinant bovine IGF2R protein. The purified recombinant IGF2R protein is obtained from the cell lysate, and its purity is determined through SDS-PAGE analysis. The resulting protein exhibits a purity level of over 90% and appears as a distinct band with a molecular weight of approximately 20 kDa on the gel.