Recombinant Bovine Vascular endothelial growth factor A (VEGFA)

In Stock Promotion
Code CSB-EP025833BO
Abbreviation Recombinant Bovine VEGFA protein
MSDS
Size $9.9
Promotion
CUSABIO Blowout: 4,780+ In-Stock Proteins
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Activity
Not Test
Target Names
Uniprot No.
Research Area
Cancer
Alternative Names
VEGF-A;Vascular permeability factor;VPF
Species
Bos taurus (Bovine)
Source
E.coli
Expression Region
27-190aa
Target Protein Sequence
APMAEGGQKPHEVVKFMDVYQRSFCRPIETLVDIFQEYPDEIEFIFKPSCVPLMRCGGCCNDESLECVPTEEFNITMQIMRIKPHQSQHIGEMSFLQHNKCECRPKKDKARQENPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
26.2 kDa
Protein Length
Full Length of Mature Protein
Tag Info
C-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Growth factor active in angiogenesis, vasculogenesis and endothelial cell growth. Induces endothelial cell proliferation, promotes cell migration, inhibits apoptosis and induces permeabilization of blood vessels. Binds to the FLT1/VEGFR1 and KDR/VEGFR2 receptors, heparan sulfate and heparin. Binding to NRP1 receptor initiates a signaling pathway needed for motor neuron axon guidance and cell body migration, including for the caudal migration of facial motor neurons from rhombomere 4 to rhombomere 6 during embryonic development.
Gene References into Functions
  1. data for the first time demonstrate a calpain/PTP1B/VEGFR2 negative feedback loop in the regulation of VEGF-induced angiogenesis. Modulation of local PTP1B and/or calpain activities may prove beneficial in the treatment of impaired wound healing in diabetes. PMID: 27872190
  2. Studied the effect of cyclic uniaxial stretch (20%, 1 Hz), with and without the stimulation of vascular endothelial growth factor (VEGF), on sprouting angiogenesis by employing a stretchable three-dimensional cell culture model. PMID: 25376776
  3. Study shows that VEGFA mRNA in mammalian endothelial cells undergoes programmed translational readthrough (PTR) generating VEGF-Ax, an isoform containing a unique 22-amino-acid C terminus extension. PMID: 24949972
  4. Data indicate that superoxide dismutase (SOD) inhibited high glucose (HG)-induced expression of uPAR and VEGF in bovine retinal microvascular endothelial cell (REC). PMID: 23951261
  5. Exposure of endothelial cells to VEGF, high glucose, or hydrogen peroxide up-regulated the XBP1/IRE1 alpha and ATF6 arms of the unfolded protein response compared with untreated cells. PMID: 23395094
  6. Microvascular endothelial cells are more susceptible than aortic cells to advanced glycation end products-enhanced permeability and that AGE-enhanced permeability is dependent on VEGF expression induced by reactive oxygen species. PMID: 21296593
  7. VEGF supports germ cell survival and sperm production in bulls. PMID: 19633133
  8. analysis of polymorphisms of bovine VEGF gene and their associations with growth traits in Chinese cattle PMID: 20376703
  9. VEGF mRNA expression at estrus was higher than at the early I, early II and late luteal stages (P<0.05), whereas VEGF protein content was greatest at the early I luteal stage and decreased thereafter PMID: 20035107
  10. Alterations in the expression of VEGF-A and bFGF systems suggest that angiogenic factors are involved in abnormal placental development in cloned gestations, contributing to impaired fetal development and poor survival rates. PMID: 20198587
  11. Advanced glycation end products increase, through a protein kinase C-dependent pathway, expression in reignal endothelial cells; inhibited by gliclazide. PMID: 12126787
  12. VEGF signaling is regulated by atrial natriuretic peptide, which preserves endothelial cell tight junction functional morphology PMID: 12213803
  13. Airline pilots are good candidates to see if mutation in the VEGF promoter are responsible for some cases of amyotrophic lateral sclerosis. PMID: 12448348
  14. role in dowregulating Flk-1/KDR involves Cbl-mediated ubiquitination PMID: 12649282
  15. interaction with glucose-6-phosphate dehydrogenase is involved in angiogenesis PMID: 12777375
  16. Results suggest that leptin might elicit angiogenesis through vascular endothelial growth factor induction as well as pigment epithelium-derived factor suppression in pericytes. PMID: 12779248
  17. Shear stress and VEGF converge at the membrane receptor Flk-1 and these stimuli share the Flk-1/Cbl/Akt pathway in activating IKK activation. PMID: 14551058
  18. Tumor cells activate confluent, quiescent EC, promoting survival, phenotypic, and gene expression changes. Of importance, VEGF antagonism converts tumor-conditioned medium from protective to endothelial cell-damaging effects. PMID: 15075216
  19. MGP plays a role in endothelial cell function, by increasing transforming growth factor-beta1 activity and stimulating VEGF expression PMID: 15456771
  20. placenta growth factor expression is regulated by both VEGF and hyperglycaemia via VEGFR-2 PMID: 15501243
  21. VEGF has a role in increasing paracellular transport PMID: 15501249
  22. Thrombospondin-1 and -2 were coordinately expressed in the extravascular compartment of the ovary during early follicle development. VEGF was inversely expressed, with expression increasing as follicles developed. PMID: 15616224
  23. the activation of VEGFR-1 and VEGFR-2 heterodimer (VEGFR-1/R-2) is essential for PGI(2) synthesis mediated by VEGF-A(165) and VEGF-A(121), which cannot be reproduced by the parallel activation of VEGFR-1 and VEGFR-2 homodimers with corresponding agonists PMID: 15637071
  24. Reciprocally, adenovirus-mediated overexpression of Cyr61 in cells cultured under static conditions increased the expression of VEGF, alpha(v)-integrin, and SM alpha-actin. PMID: 15649872
  25. peroxynitrite causes increased expression of VEGF in vascular endothelial cells by a process that requires the activation of STAT3 PMID: 16257644
  26. ROS induce expression not only of VEGF but also of VEGFR2. VEGFR2 increase by ROS is mainly driven through a NF-kappaB-dependent pathway. PMID: 16899768
  27. expression of VEGF isoforms may be associated with characterization of the preovulatory phenotype during follicle development in the bovine ovary PMID: 17043385
  28. Gab1 is a novel critical regulatory component of endothelial cell migration and capillary formation with a key role in the activation of VEGF-evoked signaling pathways required for angiogenesis PMID: 17178724
  29. The results provide support for a role for VEGF in the primary to secondary follicle transition. PMID: 17290425
  30. This study reports the temporal changes in vascular endothelial growth factor A (VEGFA), fibroblast growth factor 2 (FGF2) and osteonectin during the follicular-luteal transition and corpus luteum development in the cow. PMID: 17360962
  31. a new molecular cascade, operating in retinal bovine pericytes and involving PKCbetaII, the mRNA-stabilizing protein HuR. and VEGF. In particular we show that PKCbetaII activation is responsible, through the RNA-binding protein HuR PMID: 18206386
  32. bFGF and VEGF control the corpus luteum formation and function. PMID: 18213648
  33. VEGF has an effect on the expression of its own transcription factor, HIF-1, and on VEGF itself PMID: 18305118
  34. By regulating VEGFR2 expression and activation, PKC-epsilon expression is critical for activation of Akt and eNOS by VEGF and contributes to VEGF-stimulated Erk activation, whereas PKC-alpha has opposite effects. PMID: 18323518
  35. Angiopoietin-2 may support the angiogenic effects of VEGF-A in these corpus luteum stages. PMID: 18541291
  36. DNA methylation of VEGF in blg(+/-) was noticeably decreased. PMID: 18789616
  37. VEGF-dependent production of NO by eNOS is mediated by as cascade involving ezrin, calpain, PI-3-kinase, AMPK and AKT. PMID: 19038867
  38. ALK1 and ALK5 are both essential for correct regulation of VEGF, and that disruption of either pathway leads to disease. PMID: 19506300
  39. inhibition of NO production by Ang-1, via phosphorylation of eNOS on Thr(497) by PKC zeta, is responsible, at least in part, for inhibition of VEGF-stimulated endothelial permeability by Ang-1. PMID: 19564638

Show More

Hide All

Subcellular Location
Secreted.
Protein Families
PDGF/VEGF growth factor family
Database Links
CUSABIO guaranteed quality
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2026 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*