Recombinant Chicken Homeobox protein engrailed-1(EN1)

In Stock
Code CSB-EP007659CH
Product Type Recombinant Protein
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Uniprot No. Q05916
Lead Time 3-7 business days
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Storage Buffer Tris-based buffer,50% glycerol
Alias Short name:Gg-En-1 Short name:Homeobox protein en-1
Species Gallus gallus (Chicken)
Purity Greater than 90% as determined by SDS-PAGE.
Sequence MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE
Research Area Neuroscience
Source E.coli
Gene Names EN1
Protein Names Recommended name: Homeobox protein engrailed-1 Short name= Gg-En-1 Short name= Homeobox protein en-1
Expression Region 1-333aa
Tag Info N-terminal 6xHis-B2M-tagged
Mol. Weight 48.5kDa
Protein Description Full Length
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Still Have Questions? Leave a Message or Start an on-line Chat
Subcellular Location Nucleus
Protein Families Engrailed homeobox family
Database Links

STRING: 9031.ENSGALP00000019767

Related Products

EN1 Antibodies

EN1 Antibodies for Gallus gallus (Chicken)

EN1 Proteins

EN1 Proteins for Gallus gallus (Chicken)

Most popular with customers

Newsletters

Get all the latest information on Events, Sales and Offers. Sign up for newsletter today.

Copyright © 2007-2018 www.cusabio.com CUSABIO TECHNOLOGY LLC All Rights Reserved.

Wait!

Join the 20,000 subscribers to get research hotpots, technical tips, latest information on events, sales and offers.

Sign up now to get your $50 coupon for protein expression service!

We don't deal in spam.