Recombinant Chicken Homeobox protein engrailed-1 (EN1)

In Stock
Code CSB-EP007659CH
Abbreviation Recombinant Chicken EN1 protein
MSDS
Size $388
Order now
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.

Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
EN1
Uniprot No.
Research Area
Neuroscience
Alternative Names
EN1; EN-1; Homeobox protein engrailed-1; Gg-En-1; Homeobox protein en-1
Species
Gallus gallus (Chicken)
Source
E.coli
Expression Region
1-333aa
Target Protein Sequence
MEEPPEGHGHHRDAAPPGPANGGGGGGGGSDGDSAPVSPSPAPASPAAPCPLPLPRRRPPPPPPPRTTNFFIDNILRPDFGCKKEPPAATGAATGAGGGGGGGGREQRDGAQSAGRENVNPLLARPPHAPSSALLCPDSNCAPDGSAPAGTAAKANPGTAAGAAGAAGAAKAQGDGGETPAAKYGEHGSPAILLMGSNNGGAVLKPDSQQPLVWPAWVYCTRYSDRPSSPRTRKLKKKKTEKEDKRPRTAFTAEQLQRLKAEFQANRYITEQRRQSLAQELSLNESRVKIWFQNKRAKIKKATGIKNGLALHLMAQGLYNHSTTTVQDKEESE
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
48.5kDa
Protein Length
Full Length
Tag Info
N-terminal 6xHis-B2M-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

Recombinant Chicken Homeobox protein engrailed-1 (EN1) is produced using an E.coli expression system and contains the full-length protein sequence from 1-333 amino acids. The protein carries an N-terminal 6xHis-B2M tag for purification and detection. SDS-PAGE analysis confirms greater than 90% purity, which makes it suitable for various research applications.

Homeobox protein engrailed-1 (EN1) appears to play a vital role in developmental processes and pattern formation. Research suggests it regulates gene expression during embryonic development, with particular effects on neural and skeletal structures. Given its critical function in these pathways, EN1 has become a significant focus of research in developmental biology and related fields.

Potential Applications

Note: The applications listed below are based on what we know about this protein's biological functions, published research, and experience from experts in the field. However, we haven't fully tested all of these applications ourselves yet. We'd recommend running some preliminary tests first to make sure they work for your specific research goals.

The chicken EN1 is a homeobox transcription factor that requires correct folding of its DNA-binding domain (homeodomain) and potential dimerization for biological activity. While the B2M tag may improve solubility and folding in E. coli, prokaryotic systems lack chaperones and post-translational modifications needed for optimal folding of eukaryotic transcription factors. The high purity suggests minimal impurities, but it does not guarantee native conformation. Without experimental validation (e.g., circular dichroism for secondary structure or DNA-binding assays), the protein may be misfolded or inactive. Therefore, correct folding and bioactivity cannot be assumed and must be verified before functional applications.

1. Protein-Protein Interaction Studies

If the recombinant EN1 protein is verified to be correctly folded (e.g., through biophysical assays), it could be used in pull-down assays to study interactions with partners from tissue lysates. The His-B2M tag facilitates immobilization, but misfolding may alter binding sites or cause non-specific interactions. Results should be validated with native EN1 from eukaryotic sources to ensure physiological relevance.

2. DNA-Protein Binding Assays

Provided that the protein is confirmed to have functional DNA-binding activity (e.g., via EMSA or SPR controls), it can be used to study binding specificity and kinetics. The full-length construct includes the homeodomain, but misfolding could impair DNA recognition. Preliminary validation with known engrailed binding sequences is essential to avoid false negatives/positives.

3. Antibody Development and Validation

This recombinant EN1 is suitable as an immunogen for antibody production, as antibodies often recognize linear epitopes even in misfolded proteins. The high purity supports immunization protocols. However, antibodies generated may not bind native EN1 in physiological contexts (e.g., in chromatin). Validation against eukaryotic-expressed EN1 is critical for applications like immunofluorescence or Western blot.

4. Structural and Biophysical Characterization

The protein is appropriate for biophysical analyses (e.g., circular dichroism to assess secondary structure, dynamic light scattering to check aggregation) to evaluate folding status. However, correct folding is required for high-resolution structural studies (e.g., crystallography). A misfolded protein may yield misleading data. These assays can themselves serve as validation tools before functional use.

5. In Vitro Transcription Assays

This application requires a fully functional EN1 with DNA-binding and transcriptional regulatory activity. If bioactivity is confirmed (e.g., through complementation assays), the protein could be added to cell-free systems to study transcription. However, without validation, misfolded EN1 may fail to regulate transcription, leading to inaccurate conclusions. Pre-testing in a reconstituted system is necessary.

Final Recommendation & Action Plan

Before using this recombinant EN1 protein for any functional study, prioritize experimental validation of its folding and bioactivity. Start with biophysical assays (e.g., circular dichroism to confirm expected α-helical content in the homeodomain, size-exclusion chromatography to monitor oligomerization) to assess folding. Then, perform functional tests such as EMSA with a known EN1-binding DNA sequence to verify DNA-binding capability. If activity is confirmed, proceed with interaction or transcription assays; otherwise, limit use to non-functional applications like antibody production, but always validate outcomes with native protein.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Subcellular Location
Nucleus.
Protein Families
Engrailed homeobox family
Database Links
icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
×
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*