Code | CSB-EP328989HU |
Abbreviation | Recombinant Human HLA-A protein, partial |
MSDS | |
Size | US$388 |
Order now | |
Image |
|
Have Questions? | Leave a Message or Start an on-line Chat |
The recombinant human HLA-A is generated by expressing the target gene fragment in E.coli and fusing the 6xHis motif to the N-terminus of the resulting protein. The target gene region maps within amino acids 25-308 (extracellular domain) of the HLA-A protein. Its purity is greater than 85% measured by SDS-PAGE. It migrated to the molecular weight band of 36-40 kDa on the gel. This 6xHis-tagged recombinant HLA-A protein has also been validated its component by the LC-MS/MS analysis. It is in stock now. The target protein HLA-A is the α chain of the HLA class I molecule, which is located in the endoplasmic reticulum (ER) with peptide fragments derived from proteolytically degraded proteins. These HLA class I/peptide complexes are then surface-expressed and presented to CD8+ T cells.
There are currently no reviews for this product.
We are trying to develop a multiplexing assay on Luminex to detect the HLA Class I and II antibodies in individuals.
We are looking for manufacturer who can provide us human derived recombined HLA class I and II antigens, checked on your website and find some Locus antigens are available with you. For the panel designing we need antigens of locu A.
Could you please provide some idea about it?
GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI