Recombinant Human HLA class I histocompatibility antigen,A-1 alpha chain(HLA-A),partial

In Stock
Code CSB-EP328989HU
Size US$2466Purchase it in Cusabio online store
(only available for customers from the US)
Image
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP328989HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
  • Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP328989HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Description

The recombinant human HLA-A is generated by expressing the target gene fragment in E.coli and fusing the 6xHis motif to the N-terminus of the resulting protein. The target gene region maps within amino acids 25-308 (extracellular domain) of the HLA-A protein. Its purity is greater than 85% measured by SDS-PAGE. It migrated to the molecular weight band of 36-40 kDa on the gel. This 6xHis-tagged recombinant HLA-A protein has also been validated its component by the LC-MS/MS analysis. It is in stock now. The target protein HLA-A is the α chain of the HLA class I molecule, which is located in the endoplasmic reticulum (ER) with peptide fragments derived from proteolytically degraded proteins. These HLA class I/peptide complexes are then surface-expressed and presented to CD8+ T cells.

Purity Greater than 85% as determined by SDS-PAGE.
Target Names HLA-A
Uniprot No. P30443
Research Area Others
Species Homo sapiens (Human)
Source E.coli
Expression Region 25-308aa
Target Protein Sequence GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.
Mol. Weight 36.7 kDa
Protein Length Extracellular Domain
Tag Info N-terminal 6xHis-tagged
Form Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting
and FAQs
Protein FAQs
Storage Condition Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time 3-7 business days
Notes Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA Please contact us to get it.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

 Q&A
Q:

We are trying to develop a multiplexing assay on Luminex to detect the HLA Class I and II antibodies in individuals.
We are looking for manufacturer who can provide us human derived recombined HLA class I and II antigens, checked on your website and find some Locus antigens are available with you. For the panel designing we need antigens of locu A.
Could you please provide some idea about it?

A:
As to your request for the antigen of A, please check detailed information as follows:
We can provide all of these antigens expressed by our four expression systems: E.coli, Yeast, Baculovirus and Mammalian Cell, please check and confirm which expression system you need.
Recombinant Human HLA class I histocompatibility antigen, A-1 alpha chain(HLA-A),partial
CSB-YP328989HU >> Yeast
CSB-EP328989HU >> E.coli
CSB-BP328989HU >> Baculovirus
CSB-MP328989HU >> Mammalian cell
Expression Region:25-308aa; Partial, provide the complete extracellular domain.
Tag information:Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows: YP:N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI

Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
Address
7505 Fannin St. Ste 610-312, Houston, TX 77054, USA
Join Us with

Subscribe newsletter

Leave a message

© 2007-2022 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1