Home
Protein
Recombinant Protein
Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial

Recombinant Human HLA class I histocompatibility antigen, A alpha chain (HLA-A), partial

^{In Stock}

Code	CSB-EP328989HU
MSDS	MSDS
Size	US$388
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP328989HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A. Based on the SEQUEST from database of E.coli host and target protein, the LC-MS/MS Analysis result of CSB-EP328989HU could indicate that this peptide derived from E.coli-expressed Homo sapiens (Human) HLA-A.
Have Questions?	Leave a Message or Start an on-line Chat

Product Details
Related Products
Customer Reviews and Q&A

Product Details

Purity

Greater than 85% as determined by SDS-PAGE.

Target Names

HLA-A

Uniprot No.

P30443

Research Area

Others

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

25-308aa

Target Protein Sequence

GSHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKMEPRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGPDGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRCVDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWELSSQPTIPI
Note: The complete sequence including tag sequence, target protein sequence and linker sequence could be provided upon request.

Mol. Weight

36.7 kDa

Protein Length

Extracellular Domain

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

Tris-based buffer,50% glycerol

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The recombinant human HLA-A is generated by expressing the target gene fragment in E.coli and fusing the 6xHis motif to the N-terminus of the resulting protein. The target gene region maps within amino acids 25-308 (extracellular domain) of the HLA-A protein. Its purity is greater than 85% measured by SDS-PAGE. It migrated to the molecular weight band of 36-40 kDa on the gel. This 6xHis-tagged recombinant HLA-A protein has also been validated its component by the LC-MS/MS analysis. It is in stock now. The target protein HLA-A is the α chain of the HLA class I molecule, which is located in the endoplasmic reticulum (ER) with peptide fragments derived from proteolytically degraded proteins. These HLA class I/peptide complexes are then surface-expressed and presented to CD8+ T cells.

Customer Reviews and Q&A

■ Customer Reviews

There are currently no reviews for this product.

Submit a Review here

■ Q&A

We are trying to develop a multiplexing assay on Luminex to detect the HLA Class I and II antibodies in individuals.
We are looking for manufacturer who can provide us human derived recombined HLA class I and II antigens, checked on your website and find some Locus antigens are available with you. For the panel designing we need antigens of locu A.
Could you please provide some idea about it?

As to your request for the antigen of A, please check detailed information as follows:
We can provide all of these antigens expressed by our four expression systems: E.coli, Yeast, Baculovirus and Mammalian Cell, please check and confirm which expression system you need.
Recombinant Human HLA class I histocompatibility antigen, A-1 alpha chain(HLA-A),partial
CSB-YP328989HU >> Yeast
CSB-EP328989HU >> E.coli
CSB-BP328989HU >> Baculovirus
CSB-MP328989HU >> Mammalian cell
Expression Region:25-308aa; Partial, provide the complete extracellular domain.
Tag information:Tag type will be determined during the manufacturing process.
The expected tag for each expression system is listed as follows: YP:N-terminal 6xHis-tagged; EP, BP, MP: N-terminal 10xHis-tagged and C-terminal Myc-tagged.
Sequence:

Promotions