Recombinant Human Acyl-CoA-binding protein (DBI)

In Stock
Code CSB-EP006519HU
Abbreviation Recombinant Human DBI protein
MSDS
Size $224
Order now
Image
  • Warning: preg_replace(): Unknown modifier 'a' in /www/wwwroot/cusabio.com/caches/caches_template/20141113/content/show_product_protein.php on line 156
Have Questions? Leave a Message or Start an on-line Chat

Product Details

Purity
Greater than 90% as determined by SDS-PAGE.
Target Names
Uniprot No.
Research Area
Transport
Alternative Names
ACBD 1; ACBD1; ACBP; ACBP_HUMAN; Acyl CoA binding domain containing 1; Acyl CoA binding protein; Acyl Coenzyme A binding domain containing 1; Acyl coenzyme A binding protein; Acyl-CoA-binding protein; CCK RP; CCKRP; Cholecystokinin releasing peptide trypsin sensitive; DBI; Diazepam-binding inhibitor; Endozepine; EP; GABA receptor modulator; MGC70414
Species
Homo sapiens (Human)
Source
E.coli
Expression Region
2-104aa
Target Protein Sequence
WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.
Mol. Weight
15.7kDa
Protein Length
Full Length of Mature Protein of Isoform 2
Tag Info
N-terminal 6xHis-tagged
Form
Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.
Buffer
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.
Reconstitution
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Troubleshooting and FAQs
Storage Condition
Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Shelf Life
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Lead Time
3-7 business days
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Datasheet & COA
Please contact us to get it.
Description

The expression region of this recombinant Human DBI covers amino acids 2-104. The theoretical molecular weight of the DBI protein is 15.7 kDa. The DBI protein was expressed in e.coli. The DBI gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant DBI protein during the following stages.

The human acyl-CoA-binding protein, also known as diazepam-binding inhibitor (DBI), is a multifunctional protein primarily located in the mitochondrial matrix. Its primary role is to bind and transport long-chain fatty acyl-CoA esters, participating in lipid metabolism and cellular energy regulation. Additionally, DBI is involved in the modulation of GABAergic neurotransmission as a neuropeptide, contributing to the regulation of neuronal activity and behavior. DBI's diverse functions extend to the regulation of steroidogenesis, cellular differentiation, and apoptosis. The intricate involvement of DBI in various cellular processes makes it a key player in maintaining metabolic and neural homeostasis, with potential implications in metabolic disorders and neurological conditions.

Customer Reviews and Q&A

 Customer Reviews

There are currently no reviews for this product.

Submit a Review here

Target Background

Function
Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.
Gene References into Functions
  1. ACBP increases the activity of ceramide synthase 2 (CerS2) by more than 2-fold and CerS3 activity by 7-fold. ACBP binds very-long-chain acyl-CoA esters, which is required for its ability to stimulate CerS activity. PMID: 28320857
  2. Serum endozepine-4 levels are increased in hepatic coma. PMID: 26290636
  3. Structural and functional properties of ACBD1, commonly known as ACBP. [Review] PMID: 25898985
  4. High ACBP expression is associated with non-small cell lung cancer. PMID: 24819876
  5. results indicate that a dysfunction of the neurosteroid system might be operative in BPD in spite of unchanged DBI plasma levels. PMID: 24401326
  6. There was a significant difference in the rs2276596 polymorphism C/A allele frequency of the DBI gene (P < 0.0001) between alcoholics and healthy controls. PMID: 24818357
  7. Acyl-CoA binding protein and epidermal barrier function. [review] PMID: 24080521
  8. Endogenous potentiation of GABAergic synaptic transmission and responses to GABA uncaging in the thalamic reticular nucleus is absent in mice in which DBI is deleted and mice in which benzodiazepine binding to alpha3 subunit-containing GABAARs is disrupted. PMID: 23727119
  9. A human preadipocyte cell line SGBS is well suited to examine differential expression of the Acyl-CoA binding protein (ACBP) during adipogenesis. PMID: 21448843
  10. The regulation of novel low-abundance transcript variants of human acyl-CoA binding protein, was analysed. PMID: 20345851
  11. Gene annotation enrichment analysis revealed ACBP-mediated down-regulation of 18 genes encoding key enzymes in glycerolipid, cholesterol and fatty acid metabolism. PMID: 20511713
  12. Data suggest that the presence of gamma-glutamyl hydrolase and diazepam-binding inhibitor in urine serves as a rationale for developing them as urinary markers of clinical outcomes for patients treated with neoadjuvant chemotherapy. PMID: 19815704
  13. PPRE in intron 1 of the ACBP gene is a bona fide PPARgamma-response element. PMID: 12015306
  14. ACBP has a role as an essential protein in human cells PMID: 12396232
  15. Missense changes in diazepam binding inhibitorwere not associated with schizophrenia PMID: 14755437
  16. Data show for the first time in a physiological context that transgenic expression of acyl-coenzyme A binding protein may play a role in liver fatty acyl-coenzyme A metabolism. PMID: 16042405
  17. Results identify new acyl-CoA binding protein transcripts in human and mouse tissues, generated by alternative first exon usage. PMID: 16055366
  18. Acyl coenzyme A-binding protein has a role in augmenting bid-induced mitochondrial damage and cell death by activating mu-calpain PMID: 16908521
  19. Here high resolution crystal structures of human cytosolic liver ACBP, unliganded and liganded with a physiological ligand, myristoyl-CoA are described. The binding of the acyl-CoA molecule induces only few structural differences near the binding pocket PMID: 17044054
  20. we obtained evidence from two Caucasian study populations that the minor allele of ACBP rs2084202 might be associated with reduced risk of type 2 diabetes PMID: 17262885
  21. study found a significant difference in the +529A/T (rs8192503) polymorphism allele frequency of the DBI gene between the alcoholics & controls; data suggest that mutation allele of the DBI gene polymorphism was one of the risk factors for alcoholism PMID: 18240651
  22. ACBP is a transcriptional regulator of the HMGCS1 and HMGCR genes encoding rate-limiting enzymes of cholesterol synthesis pathway. PMID: 19088433

Show More

Hide All

Subcellular Location
Endoplasmic reticulum. Golgi apparatus.
Protein Families
ACBP family
Tissue Specificity
Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.
Database Links

HGNC: 2690

OMIM: 125950

KEGG: hsa:1622

STRING: 9606.ENSP00000440698

UniGene: Hs.78888

icon of phone
Call us
301-363-4651 (Available 9 a.m. to 5 p.m. CST from Monday to Friday)
icon of address
Address
7505 Fannin St., Ste 610, Room 7 (CUBIO Innovation Center), Houston, TX 77054, USA
icon of social media
Join us with

Subscribe newsletter

Leave a message

* To protect against spam, please pass the CAPTCHA test below.
CAPTCHA verification
© 2007-2025 CUSABIO TECHNOLOGY LLC All rights reserved. 鄂ICP备15011166号-1
Place an order now

I. Product details

*
*
*
*

II. Contact details

*
*

III. Ship To

*
*
*
*
*
*
*

IV. Bill To

*
*
*
*
*
*
*
*