Product Details

Purity

Greater than 90% as determined by SDS-PAGE.

Target Names

DBI

Uniprot No.

P07108

Research Area

Transport

Alternative Names

ACBD 1; ACBD1; ACBP; ACBP_HUMAN; Acyl CoA binding domain containing 1; Acyl CoA binding protein; Acyl Coenzyme A binding domain containing 1; Acyl coenzyme A binding protein; Acyl-CoA-binding protein; CCK RP; CCKRP; Cholecystokinin releasing peptide trypsin sensitive; DBI; Diazepam-binding inhibitor; Endozepine; EP; GABA receptor modulator; MGC70414

Species

Homo sapiens (Human)

Source

E.coli

Expression Region

2-104aa

Target Protein Sequence

WGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Note: The complete sequence may include tag sequence, target protein sequence, linker sequence and extra sequence that is translated with the protein sequence for the purpose(s) of secretion, stability, solubility, etc.
If the exact amino acid sequence of this recombinant protein is critical to your application, please explicitly request the full and complete sequence of this protein before ordering.

Mol. Weight

15.7kDa

Protein Length

Full Length of Mature Protein of Isoform 2

Tag Info

N-terminal 6xHis-tagged

Form

Liquid or Lyophilized powder
Note: We will preferentially ship the format that we have in stock, however, if you have any special requirement for the format, please remark your requirement when placing the order, we will prepare according to your demand.

Buffer

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
Note: If you have any special requirement for the glycerol content, please remark when you place the order.
If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose.

Reconstitution

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Troubleshooting and FAQs

Protein FAQs

Storage Condition

Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.

Shelf Life

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Lead Time

3-7 business days

Notes

Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.

Datasheet & COA

Please contact us to get it.

Description

The expression region of this recombinant Human DBI covers amino acids 2-104. The theoretical molecular weight of the DBI protein is 15.7 kDa. The DBI protein was expressed in e.coli. The DBI gene fragment has been modified by fusing the N-terminal 6xHis tag, providing convenience in detecting and purifying the recombinant DBI protein during the following stages.

The human acyl-CoA-binding protein, also known as diazepam-binding inhibitor (DBI), is a multifunctional protein primarily located in the mitochondrial matrix. Its primary role is to bind and transport long-chain fatty acyl-CoA esters, participating in lipid metabolism and cellular energy regulation. Additionally, DBI is involved in the modulation of GABAergic neurotransmission as a neuropeptide, contributing to the regulation of neuronal activity and behavior. DBI's diverse functions extend to the regulation of steroidogenesis, cellular differentiation, and apoptosis. The intricate involvement of DBI in various cellular processes makes it a key player in maintaining metabolic and neural homeostasis, with potential implications in metabolic disorders and neurological conditions.

Target Background

Function

Binds medium- and long-chain acyl-CoA esters with very high affinity and may function as an intracellular carrier of acyl-CoA esters. It is also able to displace diazepam from the benzodiazepine (BZD) recognition site located on the GABA type A receptor. It is therefore possible that this protein also acts as a neuropeptide to modulate the action of the GABA receptor.

Gene References into Functions

ACBP increases the activity of ceramide synthase 2 (CerS2) by more than 2-fold and CerS3 activity by 7-fold. ACBP binds very-long-chain acyl-CoA esters, which is required for its ability to stimulate CerS activity. PMID: 28320857
Serum endozepine-4 levels are increased in hepatic coma. PMID: 26290636
Structural and functional properties of ACBD1, commonly known as ACBP. [Review] PMID: 25898985
High ACBP expression is associated with non-small cell lung cancer. PMID: 24819876
results indicate that a dysfunction of the neurosteroid system might be operative in BPD in spite of unchanged DBI plasma levels. PMID: 24401326
There was a significant difference in the rs2276596 polymorphism C/A allele frequency of the DBI gene (P < 0.0001) between alcoholics and healthy controls. PMID: 24818357
Acyl-CoA binding protein and epidermal barrier function. [review] PMID: 24080521
Endogenous potentiation of GABAergic synaptic transmission and responses to GABA uncaging in the thalamic reticular nucleus is absent in mice in which DBI is deleted and mice in which benzodiazepine binding to alpha3 subunit-containing GABAARs is disrupted. PMID: 23727119
A human preadipocyte cell line SGBS is well suited to examine differential expression of the Acyl-CoA binding protein (ACBP) during adipogenesis. PMID: 21448843
The regulation of novel low-abundance transcript variants of human acyl-CoA binding protein, was analysed. PMID: 20345851
Gene annotation enrichment analysis revealed ACBP-mediated down-regulation of 18 genes encoding key enzymes in glycerolipid, cholesterol and fatty acid metabolism. PMID: 20511713
Data suggest that the presence of gamma-glutamyl hydrolase and diazepam-binding inhibitor in urine serves as a rationale for developing them as urinary markers of clinical outcomes for patients treated with neoadjuvant chemotherapy. PMID: 19815704
PPRE in intron 1 of the ACBP gene is a bona fide PPARgamma-response element. PMID: 12015306
ACBP has a role as an essential protein in human cells PMID: 12396232
Missense changes in diazepam binding inhibitorwere not associated with schizophrenia PMID: 14755437
Data show for the first time in a physiological context that transgenic expression of acyl-coenzyme A binding protein may play a role in liver fatty acyl-coenzyme A metabolism. PMID: 16042405
Results identify new acyl-CoA binding protein transcripts in human and mouse tissues, generated by alternative first exon usage. PMID: 16055366
Acyl coenzyme A-binding protein has a role in augmenting bid-induced mitochondrial damage and cell death by activating mu-calpain PMID: 16908521
Here high resolution crystal structures of human cytosolic liver ACBP, unliganded and liganded with a physiological ligand, myristoyl-CoA are described. The binding of the acyl-CoA molecule induces only few structural differences near the binding pocket PMID: 17044054
we obtained evidence from two Caucasian study populations that the minor allele of ACBP rs2084202 might be associated with reduced risk of type 2 diabetes PMID: 17262885
study found a significant difference in the +529A/T (rs8192503) polymorphism allele frequency of the DBI gene between the alcoholics & controls; data suggest that mutation allele of the DBI gene polymorphism was one of the risk factors for alcoholism PMID: 18240651
ACBP is a transcriptional regulator of the HMGCS1 and HMGCR genes encoding rate-limiting enzymes of cholesterol synthesis pathway. PMID: 19088433

Hide All

Subcellular Location

Endoplasmic reticulum. Golgi apparatus.

Protein Families

ACBP family

Tissue Specificity

Isoform 1 is ubiquitous, with a moderate expression level. Isoform 2 is ubiquitous with high level in liver and adipose tissue. Isoform 3 is ubiquitous with strong expression in adipose tissue and heart.

Database Links

HGNC: 2690

OMIM: 125950

KEGG: hsa:1622

STRING: 9606.ENSP00000440698

UniGene: Hs.78888

Code	CSB-EP006519HU
Abbreviation	Recombinant Human DBI protein
MSDS	MSDS Datasheet
Size	$224
	Order now
Image	(Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
Have Questions?	Leave a Message or Start an on-line Chat

Recombinant Human Acyl-CoA-binding protein (DBI)

Product Details

Related Products

Customer Reviews and Q&A

Target Background

×CloseMessage